mirror of
https://github.com/K-Dense-AI/claude-scientific-skills.git
synced 2026-03-27 07:09:27 +08:00
Add support for Adaptyv for protein design
This commit is contained in:
308
scientific-skills/adaptyv/reference/api_reference.md
Normal file
308
scientific-skills/adaptyv/reference/api_reference.md
Normal file
@@ -0,0 +1,308 @@
|
||||
# Adaptyv API Reference
|
||||
|
||||
## Base URL
|
||||
|
||||
```
|
||||
https://kq5jp7qj7wdqklhsxmovkzn4l40obksv.lambda-url.eu-central-1.on.aws
|
||||
```
|
||||
|
||||
## Authentication
|
||||
|
||||
All API requests require bearer token authentication in the request header:
|
||||
|
||||
```
|
||||
Authorization: Bearer YOUR_API_KEY
|
||||
```
|
||||
|
||||
To obtain API access:
|
||||
1. Contact support@adaptyvbio.com
|
||||
2. Request API access during alpha/beta period
|
||||
3. Receive your personal access token
|
||||
|
||||
Store your API key securely:
|
||||
- Use environment variables: `ADAPTYV_API_KEY`
|
||||
- Never commit API keys to version control
|
||||
- Use `.env` files with `.gitignore` for local development
|
||||
|
||||
## Endpoints
|
||||
|
||||
### Experiments
|
||||
|
||||
#### Create Experiment
|
||||
|
||||
Submit protein sequences for experimental testing.
|
||||
|
||||
**Endpoint:** `POST /experiments`
|
||||
|
||||
**Request Body:**
|
||||
```json
|
||||
{
|
||||
"sequences": ">protein1\nMKVLWALLGLLGAA...\n>protein2\nMATGVLWALLG...",
|
||||
"experiment_type": "binding|expression|thermostability|enzyme_activity",
|
||||
"target_id": "optional_target_identifier",
|
||||
"webhook_url": "https://your-webhook.com/callback",
|
||||
"metadata": {
|
||||
"project": "optional_project_name",
|
||||
"notes": "optional_notes"
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
**Sequence Format:**
|
||||
- FASTA format with headers
|
||||
- Multiple sequences supported
|
||||
- Standard amino acid codes
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"experiment_id": "exp_abc123xyz",
|
||||
"status": "submitted",
|
||||
"created_at": "2025-11-24T10:00:00Z",
|
||||
"estimated_completion": "2025-12-15T10:00:00Z"
|
||||
}
|
||||
```
|
||||
|
||||
#### Get Experiment Status
|
||||
|
||||
Check the current status of an experiment.
|
||||
|
||||
**Endpoint:** `GET /experiments/{experiment_id}`
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"experiment_id": "exp_abc123xyz",
|
||||
"status": "submitted|processing|completed|failed",
|
||||
"created_at": "2025-11-24T10:00:00Z",
|
||||
"updated_at": "2025-11-25T14:30:00Z",
|
||||
"progress": {
|
||||
"stage": "sequencing|expression|assay|analysis",
|
||||
"percentage": 45
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
**Status Values:**
|
||||
- `submitted` - Experiment received and queued
|
||||
- `processing` - Active testing in progress
|
||||
- `completed` - Results available for download
|
||||
- `failed` - Experiment encountered an error
|
||||
|
||||
#### List Experiments
|
||||
|
||||
Retrieve all experiments for your organization.
|
||||
|
||||
**Endpoint:** `GET /experiments`
|
||||
|
||||
**Query Parameters:**
|
||||
- `status` - Filter by status (optional)
|
||||
- `limit` - Number of results per page (default: 50)
|
||||
- `offset` - Pagination offset (default: 0)
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"experiments": [
|
||||
{
|
||||
"experiment_id": "exp_abc123xyz",
|
||||
"status": "completed",
|
||||
"experiment_type": "binding",
|
||||
"created_at": "2025-11-24T10:00:00Z"
|
||||
}
|
||||
],
|
||||
"total": 150,
|
||||
"limit": 50,
|
||||
"offset": 0
|
||||
}
|
||||
```
|
||||
|
||||
### Results
|
||||
|
||||
#### Get Experiment Results
|
||||
|
||||
Download results from a completed experiment.
|
||||
|
||||
**Endpoint:** `GET /experiments/{experiment_id}/results`
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"experiment_id": "exp_abc123xyz",
|
||||
"results": [
|
||||
{
|
||||
"sequence_id": "protein1",
|
||||
"measurements": {
|
||||
"kd": 1.2e-9,
|
||||
"kon": 1.5e5,
|
||||
"koff": 1.8e-4
|
||||
},
|
||||
"quality_metrics": {
|
||||
"confidence": "high",
|
||||
"r_squared": 0.98
|
||||
}
|
||||
}
|
||||
],
|
||||
"download_urls": {
|
||||
"raw_data": "https://...",
|
||||
"analysis_package": "https://...",
|
||||
"report": "https://..."
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
### Targets
|
||||
|
||||
#### Search Target Catalog
|
||||
|
||||
Search the ACROBiosystems antigen catalog.
|
||||
|
||||
**Endpoint:** `GET /targets`
|
||||
|
||||
**Query Parameters:**
|
||||
- `search` - Search term (protein name, UniProt ID, etc.)
|
||||
- `species` - Filter by species
|
||||
- `category` - Filter by category
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"targets": [
|
||||
{
|
||||
"target_id": "tgt_12345",
|
||||
"name": "Human PD-L1",
|
||||
"species": "Homo sapiens",
|
||||
"uniprot_id": "Q9NZQ7",
|
||||
"availability": "in_stock|custom_order",
|
||||
"price_usd": 450
|
||||
}
|
||||
]
|
||||
}
|
||||
```
|
||||
|
||||
#### Request Custom Target
|
||||
|
||||
Request an antigen not in the standard catalog.
|
||||
|
||||
**Endpoint:** `POST /targets/request`
|
||||
|
||||
**Request Body:**
|
||||
```json
|
||||
{
|
||||
"target_name": "Custom target name",
|
||||
"uniprot_id": "optional_uniprot_id",
|
||||
"species": "species_name",
|
||||
"notes": "Additional requirements"
|
||||
}
|
||||
```
|
||||
|
||||
### Organization
|
||||
|
||||
#### Get Credits Balance
|
||||
|
||||
Check your organization's credit balance and usage.
|
||||
|
||||
**Endpoint:** `GET /organization/credits`
|
||||
|
||||
**Response:**
|
||||
```json
|
||||
{
|
||||
"balance": 10000,
|
||||
"currency": "USD",
|
||||
"usage_this_month": 2500,
|
||||
"experiments_remaining": 22
|
||||
}
|
||||
```
|
||||
|
||||
## Webhooks
|
||||
|
||||
Configure webhook URLs to receive notifications when experiments complete.
|
||||
|
||||
**Webhook Payload:**
|
||||
```json
|
||||
{
|
||||
"event": "experiment.completed",
|
||||
"experiment_id": "exp_abc123xyz",
|
||||
"status": "completed",
|
||||
"timestamp": "2025-12-15T10:00:00Z",
|
||||
"results_url": "/experiments/exp_abc123xyz/results"
|
||||
}
|
||||
```
|
||||
|
||||
**Webhook Events:**
|
||||
- `experiment.submitted` - Experiment received
|
||||
- `experiment.started` - Processing began
|
||||
- `experiment.completed` - Results available
|
||||
- `experiment.failed` - Error occurred
|
||||
|
||||
**Security:**
|
||||
- Verify webhook signatures (details provided during onboarding)
|
||||
- Use HTTPS endpoints only
|
||||
- Respond with 200 OK to acknowledge receipt
|
||||
|
||||
## Error Handling
|
||||
|
||||
**Error Response Format:**
|
||||
```json
|
||||
{
|
||||
"error": {
|
||||
"code": "invalid_sequence",
|
||||
"message": "Sequence contains invalid amino acid codes",
|
||||
"details": {
|
||||
"sequence_id": "protein1",
|
||||
"position": 45,
|
||||
"character": "X"
|
||||
}
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
**Common Error Codes:**
|
||||
- `authentication_failed` - Invalid or missing API key
|
||||
- `invalid_sequence` - Malformed FASTA or invalid amino acids
|
||||
- `insufficient_credits` - Not enough credits for experiment
|
||||
- `target_not_found` - Specified target ID doesn't exist
|
||||
- `rate_limit_exceeded` - Too many requests
|
||||
- `experiment_not_found` - Invalid experiment ID
|
||||
- `internal_error` - Server-side error
|
||||
|
||||
## Rate Limits
|
||||
|
||||
- 100 requests per minute per API key
|
||||
- 1000 experiments per day per organization
|
||||
- Batch submissions encouraged for large-scale testing
|
||||
|
||||
When rate limited, response includes:
|
||||
```
|
||||
HTTP 429 Too Many Requests
|
||||
Retry-After: 60
|
||||
```
|
||||
|
||||
## Best Practices
|
||||
|
||||
1. **Use webhooks** for long-running experiments instead of polling
|
||||
2. **Batch sequences** when submitting multiple variants
|
||||
3. **Cache results** to avoid redundant API calls
|
||||
4. **Implement retry logic** with exponential backoff
|
||||
5. **Monitor credits** to avoid experiment failures
|
||||
6. **Validate sequences** locally before submission
|
||||
7. **Use descriptive metadata** for better experiment tracking
|
||||
|
||||
## API Versioning
|
||||
|
||||
The API is currently in alpha/beta. Breaking changes may occur but will be:
|
||||
- Announced via email to registered users
|
||||
- Documented in the changelog
|
||||
- Supported with migration guides
|
||||
|
||||
Current version is reflected in response headers:
|
||||
```
|
||||
X-API-Version: alpha-2025-11
|
||||
```
|
||||
|
||||
## Support
|
||||
|
||||
For API issues or questions:
|
||||
- Email: support@adaptyvbio.com
|
||||
- Documentation updates: https://docs.adaptyvbio.com
|
||||
- Report bugs with experiment IDs and request details
|
||||
913
scientific-skills/adaptyv/reference/examples.md
Normal file
913
scientific-skills/adaptyv/reference/examples.md
Normal file
@@ -0,0 +1,913 @@
|
||||
# Code Examples
|
||||
|
||||
## Setup and Authentication
|
||||
|
||||
### Basic Setup
|
||||
|
||||
```python
|
||||
import os
|
||||
import requests
|
||||
from dotenv import load_dotenv
|
||||
|
||||
# Load environment variables
|
||||
load_dotenv()
|
||||
|
||||
# Configuration
|
||||
API_KEY = os.getenv("ADAPTYV_API_KEY")
|
||||
BASE_URL = "https://kq5jp7qj7wdqklhsxmovkzn4l40obksv.lambda-url.eu-central-1.on.aws"
|
||||
|
||||
# Standard headers
|
||||
HEADERS = {
|
||||
"Authorization": f"Bearer {API_KEY}",
|
||||
"Content-Type": "application/json"
|
||||
}
|
||||
|
||||
def check_api_connection():
|
||||
"""Verify API connection and credentials"""
|
||||
try:
|
||||
response = requests.get(f"{BASE_URL}/organization/credits", headers=HEADERS)
|
||||
response.raise_for_status()
|
||||
print("✓ API connection successful")
|
||||
print(f" Credits remaining: {response.json()['balance']}")
|
||||
return True
|
||||
except requests.exceptions.HTTPError as e:
|
||||
print(f"✗ API authentication failed: {e}")
|
||||
return False
|
||||
```
|
||||
|
||||
### Environment Setup
|
||||
|
||||
Create a `.env` file:
|
||||
```bash
|
||||
ADAPTYV_API_KEY=your_api_key_here
|
||||
```
|
||||
|
||||
Install dependencies:
|
||||
```bash
|
||||
uv pip install requests python-dotenv
|
||||
```
|
||||
|
||||
## Experiment Submission
|
||||
|
||||
### Submit Single Sequence
|
||||
|
||||
```python
|
||||
def submit_single_experiment(sequence, experiment_type="binding", target_id=None):
|
||||
"""
|
||||
Submit a single protein sequence for testing
|
||||
|
||||
Args:
|
||||
sequence: Amino acid sequence string
|
||||
experiment_type: Type of experiment (binding, expression, thermostability, enzyme_activity)
|
||||
target_id: Optional target identifier for binding assays
|
||||
|
||||
Returns:
|
||||
Experiment ID and status
|
||||
"""
|
||||
|
||||
# Format as FASTA
|
||||
fasta_content = f">protein_sequence\n{sequence}\n"
|
||||
|
||||
payload = {
|
||||
"sequences": fasta_content,
|
||||
"experiment_type": experiment_type
|
||||
}
|
||||
|
||||
if target_id:
|
||||
payload["target_id"] = target_id
|
||||
|
||||
response = requests.post(
|
||||
f"{BASE_URL}/experiments",
|
||||
headers=HEADERS,
|
||||
json=payload
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
result = response.json()
|
||||
|
||||
print(f"✓ Experiment submitted")
|
||||
print(f" Experiment ID: {result['experiment_id']}")
|
||||
print(f" Status: {result['status']}")
|
||||
print(f" Estimated completion: {result['estimated_completion']}")
|
||||
|
||||
return result
|
||||
|
||||
# Example usage
|
||||
sequence = "MKVLWAALLGLLGAAAAFPAVTSAVKPYKAAVSAAVSKPYKAAVSAAVSKPYK"
|
||||
experiment = submit_single_experiment(sequence, experiment_type="expression")
|
||||
```
|
||||
|
||||
### Submit Multiple Sequences (Batch)
|
||||
|
||||
```python
|
||||
def submit_batch_experiment(sequences_dict, experiment_type="binding", metadata=None):
|
||||
"""
|
||||
Submit multiple protein sequences in a single batch
|
||||
|
||||
Args:
|
||||
sequences_dict: Dictionary of {name: sequence}
|
||||
experiment_type: Type of experiment
|
||||
metadata: Optional dictionary of additional information
|
||||
|
||||
Returns:
|
||||
Experiment details
|
||||
"""
|
||||
|
||||
# Format all sequences as FASTA
|
||||
fasta_content = ""
|
||||
for name, sequence in sequences_dict.items():
|
||||
fasta_content += f">{name}\n{sequence}\n"
|
||||
|
||||
payload = {
|
||||
"sequences": fasta_content,
|
||||
"experiment_type": experiment_type
|
||||
}
|
||||
|
||||
if metadata:
|
||||
payload["metadata"] = metadata
|
||||
|
||||
response = requests.post(
|
||||
f"{BASE_URL}/experiments",
|
||||
headers=HEADERS,
|
||||
json=payload
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
result = response.json()
|
||||
|
||||
print(f"✓ Batch experiment submitted")
|
||||
print(f" Experiment ID: {result['experiment_id']}")
|
||||
print(f" Sequences: {len(sequences_dict)}")
|
||||
print(f" Status: {result['status']}")
|
||||
|
||||
return result
|
||||
|
||||
# Example usage
|
||||
sequences = {
|
||||
"variant_1": "MKVLWAALLGLLGAAA...",
|
||||
"variant_2": "MKVLSAALLGLLGAAA...",
|
||||
"variant_3": "MKVLAAALLGLLGAAA...",
|
||||
"wildtype": "MKVLWAALLGLLGAAA..."
|
||||
}
|
||||
|
||||
metadata = {
|
||||
"project": "antibody_optimization",
|
||||
"round": 3,
|
||||
"notes": "Testing solubility-optimized variants"
|
||||
}
|
||||
|
||||
experiment = submit_batch_experiment(sequences, "expression", metadata)
|
||||
```
|
||||
|
||||
### Submit with Webhook Notification
|
||||
|
||||
```python
|
||||
def submit_with_webhook(sequences_dict, experiment_type, webhook_url):
|
||||
"""
|
||||
Submit experiment with webhook for completion notification
|
||||
|
||||
Args:
|
||||
sequences_dict: Dictionary of {name: sequence}
|
||||
experiment_type: Type of experiment
|
||||
webhook_url: URL to receive notification when complete
|
||||
"""
|
||||
|
||||
fasta_content = ""
|
||||
for name, sequence in sequences_dict.items():
|
||||
fasta_content += f">{name}\n{sequence}\n"
|
||||
|
||||
payload = {
|
||||
"sequences": fasta_content,
|
||||
"experiment_type": experiment_type,
|
||||
"webhook_url": webhook_url
|
||||
}
|
||||
|
||||
response = requests.post(
|
||||
f"{BASE_URL}/experiments",
|
||||
headers=HEADERS,
|
||||
json=payload
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
result = response.json()
|
||||
|
||||
print(f"✓ Experiment submitted with webhook")
|
||||
print(f" Experiment ID: {result['experiment_id']}")
|
||||
print(f" Webhook: {webhook_url}")
|
||||
|
||||
return result
|
||||
|
||||
# Example
|
||||
webhook_url = "https://your-server.com/adaptyv-webhook"
|
||||
experiment = submit_with_webhook(sequences, "binding", webhook_url)
|
||||
```
|
||||
|
||||
## Tracking Experiments
|
||||
|
||||
### Check Experiment Status
|
||||
|
||||
```python
|
||||
def check_experiment_status(experiment_id):
|
||||
"""
|
||||
Get current status of an experiment
|
||||
|
||||
Args:
|
||||
experiment_id: Experiment identifier
|
||||
|
||||
Returns:
|
||||
Status information
|
||||
"""
|
||||
|
||||
response = requests.get(
|
||||
f"{BASE_URL}/experiments/{experiment_id}",
|
||||
headers=HEADERS
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
status = response.json()
|
||||
|
||||
print(f"Experiment: {experiment_id}")
|
||||
print(f" Status: {status['status']}")
|
||||
print(f" Created: {status['created_at']}")
|
||||
print(f" Updated: {status['updated_at']}")
|
||||
|
||||
if 'progress' in status:
|
||||
print(f" Progress: {status['progress']['percentage']}%")
|
||||
print(f" Current stage: {status['progress']['stage']}")
|
||||
|
||||
return status
|
||||
|
||||
# Example
|
||||
status = check_experiment_status("exp_abc123xyz")
|
||||
```
|
||||
|
||||
### List All Experiments
|
||||
|
||||
```python
|
||||
def list_experiments(status_filter=None, limit=50):
|
||||
"""
|
||||
List experiments with optional status filtering
|
||||
|
||||
Args:
|
||||
status_filter: Filter by status (submitted, processing, completed, failed)
|
||||
limit: Maximum number of results
|
||||
|
||||
Returns:
|
||||
List of experiments
|
||||
"""
|
||||
|
||||
params = {"limit": limit}
|
||||
if status_filter:
|
||||
params["status"] = status_filter
|
||||
|
||||
response = requests.get(
|
||||
f"{BASE_URL}/experiments",
|
||||
headers=HEADERS,
|
||||
params=params
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
result = response.json()
|
||||
|
||||
print(f"Found {result['total']} experiments")
|
||||
for exp in result['experiments']:
|
||||
print(f" {exp['experiment_id']}: {exp['status']} ({exp['experiment_type']})")
|
||||
|
||||
return result['experiments']
|
||||
|
||||
# Example - list all completed experiments
|
||||
completed_experiments = list_experiments(status_filter="completed")
|
||||
```
|
||||
|
||||
### Poll Until Complete
|
||||
|
||||
```python
|
||||
import time
|
||||
|
||||
def wait_for_completion(experiment_id, check_interval=3600):
|
||||
"""
|
||||
Poll experiment status until completion
|
||||
|
||||
Args:
|
||||
experiment_id: Experiment identifier
|
||||
check_interval: Seconds between status checks (default: 1 hour)
|
||||
|
||||
Returns:
|
||||
Final status
|
||||
"""
|
||||
|
||||
print(f"Monitoring experiment {experiment_id}...")
|
||||
|
||||
while True:
|
||||
status = check_experiment_status(experiment_id)
|
||||
|
||||
if status['status'] == 'completed':
|
||||
print("✓ Experiment completed!")
|
||||
return status
|
||||
elif status['status'] == 'failed':
|
||||
print("✗ Experiment failed")
|
||||
return status
|
||||
|
||||
print(f" Status: {status['status']} - checking again in {check_interval}s")
|
||||
time.sleep(check_interval)
|
||||
|
||||
# Example (not recommended - use webhooks instead!)
|
||||
# status = wait_for_completion("exp_abc123xyz", check_interval=3600)
|
||||
```
|
||||
|
||||
## Retrieving Results
|
||||
|
||||
### Download Experiment Results
|
||||
|
||||
```python
|
||||
import json
|
||||
|
||||
def download_results(experiment_id, output_dir="results"):
|
||||
"""
|
||||
Download and parse experiment results
|
||||
|
||||
Args:
|
||||
experiment_id: Experiment identifier
|
||||
output_dir: Directory to save results
|
||||
|
||||
Returns:
|
||||
Parsed results data
|
||||
"""
|
||||
|
||||
# Get results
|
||||
response = requests.get(
|
||||
f"{BASE_URL}/experiments/{experiment_id}/results",
|
||||
headers=HEADERS
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
results = response.json()
|
||||
|
||||
# Save results JSON
|
||||
os.makedirs(output_dir, exist_ok=True)
|
||||
output_file = f"{output_dir}/{experiment_id}_results.json"
|
||||
|
||||
with open(output_file, 'w') as f:
|
||||
json.dump(results, f, indent=2)
|
||||
|
||||
print(f"✓ Results downloaded: {output_file}")
|
||||
print(f" Sequences tested: {len(results['results'])}")
|
||||
|
||||
# Download raw data if available
|
||||
if 'download_urls' in results:
|
||||
for data_type, url in results['download_urls'].items():
|
||||
print(f" {data_type} available at: {url}")
|
||||
|
||||
return results
|
||||
|
||||
# Example
|
||||
results = download_results("exp_abc123xyz")
|
||||
```
|
||||
|
||||
### Parse Binding Results
|
||||
|
||||
```python
|
||||
import pandas as pd
|
||||
|
||||
def parse_binding_results(results):
|
||||
"""
|
||||
Parse binding assay results into DataFrame
|
||||
|
||||
Args:
|
||||
results: Results dictionary from API
|
||||
|
||||
Returns:
|
||||
pandas DataFrame with organized results
|
||||
"""
|
||||
|
||||
data = []
|
||||
for result in results['results']:
|
||||
row = {
|
||||
'sequence_id': result['sequence_id'],
|
||||
'kd': result['measurements']['kd'],
|
||||
'kd_error': result['measurements']['kd_error'],
|
||||
'kon': result['measurements']['kon'],
|
||||
'koff': result['measurements']['koff'],
|
||||
'confidence': result['quality_metrics']['confidence'],
|
||||
'r_squared': result['quality_metrics']['r_squared']
|
||||
}
|
||||
data.append(row)
|
||||
|
||||
df = pd.DataFrame(data)
|
||||
|
||||
# Sort by affinity (lower KD = stronger binding)
|
||||
df = df.sort_values('kd')
|
||||
|
||||
print("Top 5 binders:")
|
||||
print(df.head())
|
||||
|
||||
return df
|
||||
|
||||
# Example
|
||||
experiment_id = "exp_abc123xyz"
|
||||
results = download_results(experiment_id)
|
||||
binding_df = parse_binding_results(results)
|
||||
|
||||
# Export to CSV
|
||||
binding_df.to_csv(f"{experiment_id}_binding_results.csv", index=False)
|
||||
```
|
||||
|
||||
### Parse Expression Results
|
||||
|
||||
```python
|
||||
def parse_expression_results(results):
|
||||
"""
|
||||
Parse expression testing results into DataFrame
|
||||
|
||||
Args:
|
||||
results: Results dictionary from API
|
||||
|
||||
Returns:
|
||||
pandas DataFrame with organized results
|
||||
"""
|
||||
|
||||
data = []
|
||||
for result in results['results']:
|
||||
row = {
|
||||
'sequence_id': result['sequence_id'],
|
||||
'yield_mg_per_l': result['measurements']['total_yield_mg_per_l'],
|
||||
'soluble_fraction': result['measurements']['soluble_fraction_percent'],
|
||||
'purity': result['measurements']['purity_percent'],
|
||||
'percentile': result['ranking']['percentile']
|
||||
}
|
||||
data.append(row)
|
||||
|
||||
df = pd.DataFrame(data)
|
||||
|
||||
# Sort by yield
|
||||
df = df.sort_values('yield_mg_per_l', ascending=False)
|
||||
|
||||
print(f"Mean yield: {df['yield_mg_per_l'].mean():.2f} mg/L")
|
||||
print(f"Top performer: {df.iloc[0]['sequence_id']} ({df.iloc[0]['yield_mg_per_l']:.2f} mg/L)")
|
||||
|
||||
return df
|
||||
|
||||
# Example
|
||||
results = download_results("exp_expression123")
|
||||
expression_df = parse_expression_results(results)
|
||||
```
|
||||
|
||||
## Target Catalog
|
||||
|
||||
### Search for Targets
|
||||
|
||||
```python
|
||||
def search_targets(query, species=None, category=None):
|
||||
"""
|
||||
Search the antigen catalog
|
||||
|
||||
Args:
|
||||
query: Search term (protein name, UniProt ID, etc.)
|
||||
species: Optional species filter
|
||||
category: Optional category filter
|
||||
|
||||
Returns:
|
||||
List of matching targets
|
||||
"""
|
||||
|
||||
params = {"search": query}
|
||||
if species:
|
||||
params["species"] = species
|
||||
if category:
|
||||
params["category"] = category
|
||||
|
||||
response = requests.get(
|
||||
f"{BASE_URL}/targets",
|
||||
headers=HEADERS,
|
||||
params=params
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
targets = response.json()['targets']
|
||||
|
||||
print(f"Found {len(targets)} targets matching '{query}':")
|
||||
for target in targets:
|
||||
print(f" {target['target_id']}: {target['name']}")
|
||||
print(f" Species: {target['species']}")
|
||||
print(f" Availability: {target['availability']}")
|
||||
print(f" Price: ${target['price_usd']}")
|
||||
|
||||
return targets
|
||||
|
||||
# Example
|
||||
targets = search_targets("PD-L1", species="Homo sapiens")
|
||||
```
|
||||
|
||||
### Request Custom Target
|
||||
|
||||
```python
|
||||
def request_custom_target(target_name, uniprot_id=None, species=None, notes=None):
|
||||
"""
|
||||
Request a custom antigen not in the standard catalog
|
||||
|
||||
Args:
|
||||
target_name: Name of the target protein
|
||||
uniprot_id: Optional UniProt identifier
|
||||
species: Species name
|
||||
notes: Additional requirements or notes
|
||||
|
||||
Returns:
|
||||
Request confirmation
|
||||
"""
|
||||
|
||||
payload = {
|
||||
"target_name": target_name,
|
||||
"species": species
|
||||
}
|
||||
|
||||
if uniprot_id:
|
||||
payload["uniprot_id"] = uniprot_id
|
||||
if notes:
|
||||
payload["notes"] = notes
|
||||
|
||||
response = requests.post(
|
||||
f"{BASE_URL}/targets/request",
|
||||
headers=HEADERS,
|
||||
json=payload
|
||||
)
|
||||
|
||||
response.raise_for_status()
|
||||
result = response.json()
|
||||
|
||||
print(f"✓ Custom target request submitted")
|
||||
print(f" Request ID: {result['request_id']}")
|
||||
print(f" Status: {result['status']}")
|
||||
|
||||
return result
|
||||
|
||||
# Example
|
||||
request = request_custom_target(
|
||||
target_name="Novel receptor XYZ",
|
||||
uniprot_id="P12345",
|
||||
species="Mus musculus",
|
||||
notes="Need high purity for structural studies"
|
||||
)
|
||||
```
|
||||
|
||||
## Complete Workflows
|
||||
|
||||
### End-to-End Binding Assay
|
||||
|
||||
```python
|
||||
def complete_binding_workflow(sequences_dict, target_id, project_name):
|
||||
"""
|
||||
Complete workflow: submit sequences, track, and retrieve binding results
|
||||
|
||||
Args:
|
||||
sequences_dict: Dictionary of {name: sequence}
|
||||
target_id: Target identifier from catalog
|
||||
project_name: Project name for metadata
|
||||
|
||||
Returns:
|
||||
DataFrame with binding results
|
||||
"""
|
||||
|
||||
print("=== Starting Binding Assay Workflow ===")
|
||||
|
||||
# Step 1: Submit experiment
|
||||
print("\n1. Submitting experiment...")
|
||||
metadata = {
|
||||
"project": project_name,
|
||||
"target": target_id
|
||||
}
|
||||
|
||||
experiment = submit_batch_experiment(
|
||||
sequences_dict,
|
||||
experiment_type="binding",
|
||||
metadata=metadata
|
||||
)
|
||||
|
||||
experiment_id = experiment['experiment_id']
|
||||
|
||||
# Step 2: Save experiment info
|
||||
print("\n2. Saving experiment details...")
|
||||
with open(f"{experiment_id}_info.json", 'w') as f:
|
||||
json.dump(experiment, f, indent=2)
|
||||
|
||||
print(f"✓ Experiment {experiment_id} submitted")
|
||||
print(" Results will be available in ~21 days")
|
||||
print(" Use webhook or poll status for updates")
|
||||
|
||||
# Note: In practice, wait for completion before this step
|
||||
# print("\n3. Waiting for completion...")
|
||||
# status = wait_for_completion(experiment_id)
|
||||
|
||||
# print("\n4. Downloading results...")
|
||||
# results = download_results(experiment_id)
|
||||
|
||||
# print("\n5. Parsing results...")
|
||||
# df = parse_binding_results(results)
|
||||
|
||||
# return df
|
||||
|
||||
return experiment_id
|
||||
|
||||
# Example
|
||||
antibody_variants = {
|
||||
"variant_1": "EVQLVESGGGLVQPGG...",
|
||||
"variant_2": "EVQLVESGGGLVQPGS...",
|
||||
"variant_3": "EVQLVESGGGLVQPGA...",
|
||||
"wildtype": "EVQLVESGGGLVQPGG..."
|
||||
}
|
||||
|
||||
experiment_id = complete_binding_workflow(
|
||||
antibody_variants,
|
||||
target_id="tgt_pdl1_human",
|
||||
project_name="antibody_affinity_maturation"
|
||||
)
|
||||
```
|
||||
|
||||
### Optimization + Testing Pipeline
|
||||
|
||||
```python
|
||||
# Combine computational optimization with experimental testing
|
||||
|
||||
def optimization_and_testing_pipeline(initial_sequences, experiment_type="expression"):
|
||||
"""
|
||||
Complete pipeline: optimize sequences computationally, then submit for testing
|
||||
|
||||
Args:
|
||||
initial_sequences: Dictionary of {name: sequence}
|
||||
experiment_type: Type of experiment
|
||||
|
||||
Returns:
|
||||
Experiment ID for tracking
|
||||
"""
|
||||
|
||||
print("=== Optimization and Testing Pipeline ===")
|
||||
|
||||
# Step 1: Computational optimization
|
||||
print("\n1. Computational optimization...")
|
||||
from protein_optimization import complete_optimization_pipeline
|
||||
|
||||
optimized = complete_optimization_pipeline(initial_sequences)
|
||||
|
||||
print(f"✓ Optimization complete")
|
||||
print(f" Started with: {len(initial_sequences)} sequences")
|
||||
print(f" Optimized to: {len(optimized)} sequences")
|
||||
|
||||
# Step 2: Select top candidates
|
||||
print("\n2. Selecting top candidates for testing...")
|
||||
top_candidates = optimized[:50] # Top 50
|
||||
|
||||
sequences_to_test = {
|
||||
seq_data['name']: seq_data['sequence']
|
||||
for seq_data in top_candidates
|
||||
}
|
||||
|
||||
# Step 3: Submit for experimental validation
|
||||
print("\n3. Submitting to Adaptyv...")
|
||||
metadata = {
|
||||
"optimization_method": "computational_pipeline",
|
||||
"initial_library_size": len(initial_sequences),
|
||||
"computational_scores": [s['combined'] for s in top_candidates]
|
||||
}
|
||||
|
||||
experiment = submit_batch_experiment(
|
||||
sequences_to_test,
|
||||
experiment_type=experiment_type,
|
||||
metadata=metadata
|
||||
)
|
||||
|
||||
print(f"✓ Pipeline complete")
|
||||
print(f" Experiment ID: {experiment['experiment_id']}")
|
||||
|
||||
return experiment['experiment_id']
|
||||
|
||||
# Example
|
||||
initial_library = {
|
||||
f"variant_{i}": generate_random_sequence()
|
||||
for i in range(1000)
|
||||
}
|
||||
|
||||
experiment_id = optimization_and_testing_pipeline(
|
||||
initial_library,
|
||||
experiment_type="expression"
|
||||
)
|
||||
```
|
||||
|
||||
### Batch Result Analysis
|
||||
|
||||
```python
|
||||
def analyze_multiple_experiments(experiment_ids):
|
||||
"""
|
||||
Download and analyze results from multiple experiments
|
||||
|
||||
Args:
|
||||
experiment_ids: List of experiment identifiers
|
||||
|
||||
Returns:
|
||||
Combined DataFrame with all results
|
||||
"""
|
||||
|
||||
all_results = []
|
||||
|
||||
for exp_id in experiment_ids:
|
||||
print(f"Processing {exp_id}...")
|
||||
|
||||
# Download results
|
||||
results = download_results(exp_id, output_dir=f"results/{exp_id}")
|
||||
|
||||
# Parse based on experiment type
|
||||
exp_type = results.get('experiment_type', 'unknown')
|
||||
|
||||
if exp_type == 'binding':
|
||||
df = parse_binding_results(results)
|
||||
df['experiment_id'] = exp_id
|
||||
all_results.append(df)
|
||||
|
||||
elif exp_type == 'expression':
|
||||
df = parse_expression_results(results)
|
||||
df['experiment_id'] = exp_id
|
||||
all_results.append(df)
|
||||
|
||||
# Combine all results
|
||||
combined_df = pd.concat(all_results, ignore_index=True)
|
||||
|
||||
print(f"\n✓ Analysis complete")
|
||||
print(f" Total experiments: {len(experiment_ids)}")
|
||||
print(f" Total sequences: {len(combined_df)}")
|
||||
|
||||
return combined_df
|
||||
|
||||
# Example
|
||||
experiment_ids = [
|
||||
"exp_round1_abc",
|
||||
"exp_round2_def",
|
||||
"exp_round3_ghi"
|
||||
]
|
||||
|
||||
all_data = analyze_multiple_experiments(experiment_ids)
|
||||
all_data.to_csv("combined_results.csv", index=False)
|
||||
```
|
||||
|
||||
## Error Handling
|
||||
|
||||
### Robust API Wrapper
|
||||
|
||||
```python
|
||||
import time
|
||||
from requests.exceptions import RequestException, HTTPError
|
||||
|
||||
def api_request_with_retry(method, url, max_retries=3, backoff_factor=2, **kwargs):
|
||||
"""
|
||||
Make API request with retry logic and error handling
|
||||
|
||||
Args:
|
||||
method: HTTP method (GET, POST, etc.)
|
||||
url: Request URL
|
||||
max_retries: Maximum number of retry attempts
|
||||
backoff_factor: Exponential backoff multiplier
|
||||
**kwargs: Additional arguments for requests
|
||||
|
||||
Returns:
|
||||
Response object
|
||||
|
||||
Raises:
|
||||
RequestException: If all retries fail
|
||||
"""
|
||||
|
||||
for attempt in range(max_retries):
|
||||
try:
|
||||
response = requests.request(method, url, **kwargs)
|
||||
response.raise_for_status()
|
||||
return response
|
||||
|
||||
except HTTPError as e:
|
||||
if e.response.status_code == 429: # Rate limit
|
||||
wait_time = backoff_factor ** attempt
|
||||
print(f"Rate limited. Waiting {wait_time}s...")
|
||||
time.sleep(wait_time)
|
||||
continue
|
||||
|
||||
elif e.response.status_code >= 500: # Server error
|
||||
if attempt < max_retries - 1:
|
||||
wait_time = backoff_factor ** attempt
|
||||
print(f"Server error. Retrying in {wait_time}s...")
|
||||
time.sleep(wait_time)
|
||||
continue
|
||||
else:
|
||||
raise
|
||||
|
||||
else: # Client error (4xx) - don't retry
|
||||
error_data = e.response.json() if e.response.content else {}
|
||||
print(f"API Error: {error_data.get('error', {}).get('message', str(e))}")
|
||||
raise
|
||||
|
||||
except RequestException as e:
|
||||
if attempt < max_retries - 1:
|
||||
wait_time = backoff_factor ** attempt
|
||||
print(f"Request failed. Retrying in {wait_time}s...")
|
||||
time.sleep(wait_time)
|
||||
continue
|
||||
else:
|
||||
raise
|
||||
|
||||
raise RequestException(f"Failed after {max_retries} attempts")
|
||||
|
||||
# Example usage
|
||||
response = api_request_with_retry(
|
||||
"POST",
|
||||
f"{BASE_URL}/experiments",
|
||||
headers=HEADERS,
|
||||
json={"sequences": fasta_content, "experiment_type": "binding"}
|
||||
)
|
||||
```
|
||||
|
||||
## Utility Functions
|
||||
|
||||
### Validate FASTA Format
|
||||
|
||||
```python
|
||||
def validate_fasta(fasta_string):
|
||||
"""
|
||||
Validate FASTA format and sequences
|
||||
|
||||
Args:
|
||||
fasta_string: FASTA-formatted string
|
||||
|
||||
Returns:
|
||||
Tuple of (is_valid, error_message)
|
||||
"""
|
||||
|
||||
lines = fasta_string.strip().split('\n')
|
||||
|
||||
if not lines:
|
||||
return False, "Empty FASTA content"
|
||||
|
||||
if not lines[0].startswith('>'):
|
||||
return False, "FASTA must start with header line (>)"
|
||||
|
||||
valid_amino_acids = set("ACDEFGHIKLMNPQRSTVWY")
|
||||
current_header = None
|
||||
|
||||
for i, line in enumerate(lines):
|
||||
if line.startswith('>'):
|
||||
if not line[1:].strip():
|
||||
return False, f"Line {i+1}: Empty header"
|
||||
current_header = line[1:].strip()
|
||||
|
||||
else:
|
||||
if current_header is None:
|
||||
return False, f"Line {i+1}: Sequence before header"
|
||||
|
||||
sequence = line.strip().upper()
|
||||
invalid = set(sequence) - valid_amino_acids
|
||||
|
||||
if invalid:
|
||||
return False, f"Line {i+1}: Invalid amino acids: {invalid}"
|
||||
|
||||
return True, None
|
||||
|
||||
# Example
|
||||
fasta = ">protein1\nMKVLWAALLG\n>protein2\nMATGVLWALG"
|
||||
is_valid, error = validate_fasta(fasta)
|
||||
|
||||
if is_valid:
|
||||
print("✓ FASTA format valid")
|
||||
else:
|
||||
print(f"✗ FASTA validation failed: {error}")
|
||||
```
|
||||
|
||||
### Format Sequences to FASTA
|
||||
|
||||
```python
|
||||
def sequences_to_fasta(sequences_dict):
|
||||
"""
|
||||
Convert dictionary of sequences to FASTA format
|
||||
|
||||
Args:
|
||||
sequences_dict: Dictionary of {name: sequence}
|
||||
|
||||
Returns:
|
||||
FASTA-formatted string
|
||||
"""
|
||||
|
||||
fasta_content = ""
|
||||
for name, sequence in sequences_dict.items():
|
||||
# Clean sequence (remove whitespace, ensure uppercase)
|
||||
clean_seq = ''.join(sequence.split()).upper()
|
||||
|
||||
# Validate
|
||||
is_valid, error = validate_fasta(f">{name}\n{clean_seq}")
|
||||
if not is_valid:
|
||||
raise ValueError(f"Invalid sequence '{name}': {error}")
|
||||
|
||||
fasta_content += f">{name}\n{clean_seq}\n"
|
||||
|
||||
return fasta_content
|
||||
|
||||
# Example
|
||||
sequences = {
|
||||
"var1": "MKVLWAALLG",
|
||||
"var2": "MATGVLWALG"
|
||||
}
|
||||
|
||||
fasta = sequences_to_fasta(sequences)
|
||||
print(fasta)
|
||||
```
|
||||
360
scientific-skills/adaptyv/reference/experiments.md
Normal file
360
scientific-skills/adaptyv/reference/experiments.md
Normal file
@@ -0,0 +1,360 @@
|
||||
# Experiment Types and Workflows
|
||||
|
||||
## Overview
|
||||
|
||||
Adaptyv provides multiple experimental assay types for comprehensive protein characterization. Each experiment type has specific applications, workflows, and data outputs.
|
||||
|
||||
## Binding Assays
|
||||
|
||||
### Description
|
||||
|
||||
Measure protein-target interactions using biolayer interferometry (BLI), a label-free technique that monitors biomolecular binding in real-time.
|
||||
|
||||
### Use Cases
|
||||
|
||||
- Antibody-antigen binding characterization
|
||||
- Receptor-ligand interaction analysis
|
||||
- Protein-protein interaction studies
|
||||
- Affinity maturation screening
|
||||
- Epitope binning experiments
|
||||
|
||||
### Technology: Biolayer Interferometry (BLI)
|
||||
|
||||
BLI measures the interference pattern of reflected light from two surfaces:
|
||||
- **Reference layer** - Biosensor tip surface
|
||||
- **Biological layer** - Accumulated bound molecules
|
||||
|
||||
As molecules bind, the optical thickness increases, causing a wavelength shift proportional to binding.
|
||||
|
||||
**Advantages:**
|
||||
- Label-free detection
|
||||
- Real-time kinetics
|
||||
- High-throughput compatible
|
||||
- Works in crude samples
|
||||
- Minimal sample consumption
|
||||
|
||||
### Measured Parameters
|
||||
|
||||
**Kinetic constants:**
|
||||
- **KD** - Equilibrium dissociation constant (binding affinity)
|
||||
- **kon** - Association rate constant (binding speed)
|
||||
- **koff** - Dissociation rate constant (unbinding speed)
|
||||
|
||||
**Typical ranges:**
|
||||
- Strong binders: KD < 1 nM
|
||||
- Moderate binders: KD = 1-100 nM
|
||||
- Weak binders: KD > 100 nM
|
||||
|
||||
### Workflow
|
||||
|
||||
1. **Sequence submission** - Provide protein sequences in FASTA format
|
||||
2. **Expression** - Proteins expressed in appropriate host system
|
||||
3. **Purification** - Automated purification protocols
|
||||
4. **BLI assay** - Real-time binding measurements against specified targets
|
||||
5. **Analysis** - Kinetic curve fitting and quality assessment
|
||||
6. **Results delivery** - Binding parameters with confidence metrics
|
||||
|
||||
### Sample Requirements
|
||||
|
||||
- Protein sequence (standard amino acid codes)
|
||||
- Target specification (from catalog or custom request)
|
||||
- Buffer conditions (standard or custom)
|
||||
- Expected concentration range (optional, improves assay design)
|
||||
|
||||
### Results Format
|
||||
|
||||
```json
|
||||
{
|
||||
"sequence_id": "antibody_variant_1",
|
||||
"target": "Human PD-L1",
|
||||
"measurements": {
|
||||
"kd": 2.5e-9,
|
||||
"kd_error": 0.3e-9,
|
||||
"kon": 1.8e5,
|
||||
"kon_error": 0.2e5,
|
||||
"koff": 4.5e-4,
|
||||
"koff_error": 0.5e-4
|
||||
},
|
||||
"quality_metrics": {
|
||||
"confidence": "high|medium|low",
|
||||
"r_squared": 0.97,
|
||||
"chi_squared": 0.02,
|
||||
"flags": []
|
||||
},
|
||||
"raw_data_url": "https://..."
|
||||
}
|
||||
```
|
||||
|
||||
## Expression Testing
|
||||
|
||||
### Description
|
||||
|
||||
Quantify protein expression levels in various host systems to assess producibility and optimize sequences for manufacturing.
|
||||
|
||||
### Use Cases
|
||||
|
||||
- Screening variants for high expression
|
||||
- Optimizing codon usage
|
||||
- Identifying expression bottlenecks
|
||||
- Selecting candidates for scale-up
|
||||
- Comparing expression systems
|
||||
|
||||
### Host Systems
|
||||
|
||||
Available expression platforms:
|
||||
- **E. coli** - Rapid, cost-effective, prokaryotic system
|
||||
- **Mammalian cells** - Native post-translational modifications
|
||||
- **Yeast** - Eukaryotic system with simpler growth requirements
|
||||
- **Insect cells** - Alternative eukaryotic platform
|
||||
|
||||
### Measured Parameters
|
||||
|
||||
- **Total protein yield** (mg/L culture)
|
||||
- **Soluble fraction** (percentage)
|
||||
- **Purity** (after initial purification)
|
||||
- **Expression time course** (optional)
|
||||
|
||||
### Workflow
|
||||
|
||||
1. **Sequence submission** - Provide protein sequences
|
||||
2. **Construct generation** - Cloning into expression vectors
|
||||
3. **Expression** - Culture in specified host system
|
||||
4. **Quantification** - Protein measurement via multiple methods
|
||||
5. **Analysis** - Expression level comparison and ranking
|
||||
6. **Results delivery** - Yield data and recommendations
|
||||
|
||||
### Results Format
|
||||
|
||||
```json
|
||||
{
|
||||
"sequence_id": "variant_1",
|
||||
"host_system": "E. coli",
|
||||
"measurements": {
|
||||
"total_yield_mg_per_l": 25.5,
|
||||
"soluble_fraction_percent": 78,
|
||||
"purity_percent": 92
|
||||
},
|
||||
"ranking": {
|
||||
"percentile": 85,
|
||||
"notes": "High expression, good solubility"
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
## Thermostability Testing
|
||||
|
||||
### Description
|
||||
|
||||
Measure protein thermal stability to assess structural integrity, predict shelf-life, and identify stabilizing mutations.
|
||||
|
||||
### Use Cases
|
||||
|
||||
- Selecting thermally stable variants
|
||||
- Formulation development
|
||||
- Shelf-life prediction
|
||||
- Stability-driven protein engineering
|
||||
- Quality control screening
|
||||
|
||||
### Measurement Techniques
|
||||
|
||||
**Differential Scanning Fluorimetry (DSF):**
|
||||
- Monitors protein unfolding via fluorescent dye binding
|
||||
- Determines melting temperature (Tm)
|
||||
- High-throughput capable
|
||||
|
||||
**Circular Dichroism (CD):**
|
||||
- Secondary structure analysis
|
||||
- Thermal unfolding curves
|
||||
- Reversibility assessment
|
||||
|
||||
### Measured Parameters
|
||||
|
||||
- **Tm** - Melting temperature (midpoint of unfolding)
|
||||
- **ΔH** - Enthalpy of unfolding
|
||||
- **Aggregation temperature** (Tagg)
|
||||
- **Reversibility** - Refolding after heating
|
||||
|
||||
### Workflow
|
||||
|
||||
1. **Sequence submission** - Provide protein sequences
|
||||
2. **Expression and purification** - Standard protocols
|
||||
3. **Thermostability assay** - Temperature gradient analysis
|
||||
4. **Data analysis** - Curve fitting and parameter extraction
|
||||
5. **Results delivery** - Stability metrics with ranking
|
||||
|
||||
### Results Format
|
||||
|
||||
```json
|
||||
{
|
||||
"sequence_id": "variant_1",
|
||||
"measurements": {
|
||||
"tm_celsius": 68.5,
|
||||
"tm_error": 0.5,
|
||||
"tagg_celsius": 72.0,
|
||||
"reversibility_percent": 85
|
||||
},
|
||||
"quality_metrics": {
|
||||
"curve_quality": "excellent",
|
||||
"cooperativity": "two-state"
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
## Enzyme Activity Assays
|
||||
|
||||
### Description
|
||||
|
||||
Measure enzymatic function including substrate turnover, catalytic efficiency, and inhibitor sensitivity.
|
||||
|
||||
### Use Cases
|
||||
|
||||
- Screening enzyme variants for improved activity
|
||||
- Substrate specificity profiling
|
||||
- Inhibitor testing
|
||||
- pH and temperature optimization
|
||||
- Mechanistic studies
|
||||
|
||||
### Assay Types
|
||||
|
||||
**Continuous assays:**
|
||||
- Chromogenic substrates
|
||||
- Fluorogenic substrates
|
||||
- Real-time monitoring
|
||||
|
||||
**Endpoint assays:**
|
||||
- HPLC quantification
|
||||
- Mass spectrometry
|
||||
- Colorimetric detection
|
||||
|
||||
### Measured Parameters
|
||||
|
||||
**Kinetic parameters:**
|
||||
- **kcat** - Turnover number (catalytic rate constant)
|
||||
- **KM** - Michaelis constant (substrate affinity)
|
||||
- **kcat/KM** - Catalytic efficiency
|
||||
- **IC50** - Inhibitor concentration for 50% inhibition
|
||||
|
||||
**Activity metrics:**
|
||||
- Specific activity (units/mg protein)
|
||||
- Relative activity vs. reference
|
||||
- Substrate specificity profile
|
||||
|
||||
### Workflow
|
||||
|
||||
1. **Sequence submission** - Provide enzyme sequences
|
||||
2. **Expression and purification** - Optimized for activity retention
|
||||
3. **Activity assay** - Substrate turnover measurements
|
||||
4. **Kinetic analysis** - Michaelis-Menten fitting
|
||||
5. **Results delivery** - Kinetic parameters and rankings
|
||||
|
||||
### Results Format
|
||||
|
||||
```json
|
||||
{
|
||||
"sequence_id": "enzyme_variant_1",
|
||||
"substrate": "substrate_name",
|
||||
"measurements": {
|
||||
"kcat_per_second": 125,
|
||||
"km_micromolar": 45,
|
||||
"kcat_km": 2.8,
|
||||
"specific_activity": 180
|
||||
},
|
||||
"quality_metrics": {
|
||||
"confidence": "high",
|
||||
"r_squared": 0.99
|
||||
},
|
||||
"ranking": {
|
||||
"relative_activity": 1.8,
|
||||
"improvement_vs_wildtype": "80%"
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
## Experiment Design Best Practices
|
||||
|
||||
### Sequence Submission
|
||||
|
||||
1. **Use clear identifiers** - Name sequences descriptively
|
||||
2. **Include controls** - Submit wild-type or reference sequences
|
||||
3. **Batch similar variants** - Group related sequences in single submission
|
||||
4. **Validate sequences** - Check for errors before submission
|
||||
|
||||
### Sample Size
|
||||
|
||||
- **Pilot studies** - 5-10 sequences to test feasibility
|
||||
- **Library screening** - 50-500 sequences for variant exploration
|
||||
- **Focused optimization** - 10-50 sequences for fine-tuning
|
||||
- **Large-scale campaigns** - 500+ sequences for ML-driven design
|
||||
|
||||
### Quality Control
|
||||
|
||||
Adaptyv includes automated QC steps:
|
||||
- Expression verification before assay
|
||||
- Replicate measurements for reliability
|
||||
- Positive/negative controls in each batch
|
||||
- Statistical validation of results
|
||||
|
||||
### Timeline Expectations
|
||||
|
||||
**Standard turnaround:** ~21 days from submission to results
|
||||
|
||||
**Timeline breakdown:**
|
||||
- Construct generation: 3-5 days
|
||||
- Expression: 5-7 days
|
||||
- Purification: 2-3 days
|
||||
- Assay execution: 3-5 days
|
||||
- Analysis and QC: 2-3 days
|
||||
|
||||
**Factors affecting timeline:**
|
||||
- Custom targets (add 1-2 weeks)
|
||||
- Novel assay development (add 2-4 weeks)
|
||||
- Large batch sizes (may add 1 week)
|
||||
|
||||
### Cost Optimization
|
||||
|
||||
1. **Batch submissions** - Lower per-sequence cost
|
||||
2. **Standard targets** - Catalog antigens are faster/cheaper
|
||||
3. **Standard conditions** - Custom buffers add cost
|
||||
4. **Computational pre-filtering** - Submit only promising candidates
|
||||
|
||||
## Combining Experiment Types
|
||||
|
||||
For comprehensive protein characterization, combine multiple assays:
|
||||
|
||||
**Therapeutic antibody development:**
|
||||
1. Binding assay → Identify high-affinity binders
|
||||
2. Expression testing → Select manufacturable candidates
|
||||
3. Thermostability → Ensure formulation stability
|
||||
|
||||
**Enzyme engineering:**
|
||||
1. Activity assay → Screen for improved catalysis
|
||||
2. Expression testing → Ensure producibility
|
||||
3. Thermostability → Validate industrial robustness
|
||||
|
||||
**Sequential vs. Parallel:**
|
||||
- **Sequential** - Use results from early assays to filter candidates
|
||||
- **Parallel** - Run all assays simultaneously for faster results
|
||||
|
||||
## Data Integration
|
||||
|
||||
Results integrate with computational workflows:
|
||||
|
||||
1. **Download raw data** via API
|
||||
2. **Parse results** into standardized format
|
||||
3. **Feed into ML models** for next-round design
|
||||
4. **Track experiments** with metadata tags
|
||||
5. **Visualize trends** across design iterations
|
||||
|
||||
## Support and Troubleshooting
|
||||
|
||||
**Common issues:**
|
||||
- Low expression → Consider sequence optimization (see protein_optimization.md)
|
||||
- Poor binding → Verify target specification and expected range
|
||||
- Variable results → Check sequence quality and controls
|
||||
- Incomplete data → Contact support with experiment ID
|
||||
|
||||
**Getting help:**
|
||||
- Email: support@adaptyvbio.com
|
||||
- Include experiment ID and specific question
|
||||
- Provide context (design goals, expected results)
|
||||
- Response time: <24 hours for active experiments
|
||||
637
scientific-skills/adaptyv/reference/protein_optimization.md
Normal file
637
scientific-skills/adaptyv/reference/protein_optimization.md
Normal file
@@ -0,0 +1,637 @@
|
||||
# Protein Sequence Optimization
|
||||
|
||||
## Overview
|
||||
|
||||
Before submitting protein sequences for experimental testing, use computational tools to optimize sequences for improved expression, solubility, and stability. This pre-screening reduces experimental costs and increases success rates.
|
||||
|
||||
## Common Protein Expression Problems
|
||||
|
||||
### 1. Unpaired Cysteines
|
||||
|
||||
**Problem:**
|
||||
- Unpaired cysteines form unwanted disulfide bonds
|
||||
- Leads to aggregation and misfolding
|
||||
- Reduces expression yield and stability
|
||||
|
||||
**Solution:**
|
||||
- Remove unpaired cysteines unless functionally necessary
|
||||
- Pair cysteines appropriately for structural disulfides
|
||||
- Replace with serine or alanine in non-critical positions
|
||||
|
||||
**Example:**
|
||||
```python
|
||||
# Check for cysteine pairs
|
||||
from Bio.Seq import Seq
|
||||
|
||||
def check_cysteines(sequence):
|
||||
cys_count = sequence.count('C')
|
||||
if cys_count % 2 != 0:
|
||||
print(f"Warning: Odd number of cysteines ({cys_count})")
|
||||
return cys_count
|
||||
```
|
||||
|
||||
### 2. Excessive Hydrophobicity
|
||||
|
||||
**Problem:**
|
||||
- Long hydrophobic patches promote aggregation
|
||||
- Exposed hydrophobic residues drive protein clumping
|
||||
- Poor solubility in aqueous buffers
|
||||
|
||||
**Solution:**
|
||||
- Maintain balanced hydropathy profiles
|
||||
- Use short, flexible linkers between domains
|
||||
- Reduce surface-exposed hydrophobic residues
|
||||
|
||||
**Metrics:**
|
||||
- Kyte-Doolittle hydropathy plots
|
||||
- GRAVY score (Grand Average of Hydropathy)
|
||||
- pSAE (percent Solvent-Accessible hydrophobic residues)
|
||||
|
||||
### 3. Low Solubility
|
||||
|
||||
**Problem:**
|
||||
- Proteins precipitate during expression or purification
|
||||
- Inclusion body formation
|
||||
- Difficult downstream processing
|
||||
|
||||
**Solution:**
|
||||
- Use solubility prediction tools for pre-screening
|
||||
- Apply sequence optimization algorithms
|
||||
- Add solubilizing tags if needed
|
||||
|
||||
## Computational Tools for Optimization
|
||||
|
||||
### NetSolP - Initial Solubility Screening
|
||||
|
||||
**Purpose:** Fast solubility prediction for filtering sequences.
|
||||
|
||||
**Method:** Machine learning model trained on E. coli expression data.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Install: uv pip install requests
|
||||
import requests
|
||||
|
||||
def predict_solubility_netsolp(sequence):
|
||||
"""Predict protein solubility using NetSolP web service"""
|
||||
url = "https://services.healthtech.dtu.dk/services/NetSolP-1.0/api/predict"
|
||||
|
||||
data = {
|
||||
"sequence": sequence,
|
||||
"format": "fasta"
|
||||
}
|
||||
|
||||
response = requests.post(url, data=data)
|
||||
return response.json()
|
||||
|
||||
# Example
|
||||
sequence = "MKVLWAALLGLLGAAA..."
|
||||
result = predict_solubility_netsolp(sequence)
|
||||
print(f"Solubility score: {result['score']}")
|
||||
```
|
||||
|
||||
**Interpretation:**
|
||||
- Score > 0.5: Likely soluble
|
||||
- Score < 0.5: Likely insoluble
|
||||
- Use for initial filtering before more expensive predictions
|
||||
|
||||
**When to use:**
|
||||
- First-pass filtering of large libraries
|
||||
- Quick validation of designed sequences
|
||||
- Prioritizing sequences for experimental testing
|
||||
|
||||
### SoluProt - Comprehensive Solubility Prediction
|
||||
|
||||
**Purpose:** Advanced solubility prediction with higher accuracy.
|
||||
|
||||
**Method:** Deep learning model incorporating sequence and structural features.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Install: uv pip install soluprot
|
||||
from soluprot import predict_solubility
|
||||
|
||||
def screen_variants_soluprot(sequences):
|
||||
"""Screen multiple sequences for solubility"""
|
||||
results = []
|
||||
for name, seq in sequences.items():
|
||||
score = predict_solubility(seq)
|
||||
results.append({
|
||||
'name': name,
|
||||
'sequence': seq,
|
||||
'solubility_score': score,
|
||||
'predicted_soluble': score > 0.6
|
||||
})
|
||||
return results
|
||||
|
||||
# Example
|
||||
sequences = {
|
||||
'variant_1': 'MKVLW...',
|
||||
'variant_2': 'MATGV...'
|
||||
}
|
||||
|
||||
results = screen_variants_soluprot(sequences)
|
||||
soluble_variants = [r for r in results if r['predicted_soluble']]
|
||||
```
|
||||
|
||||
**Interpretation:**
|
||||
- Score > 0.6: High solubility confidence
|
||||
- Score 0.4-0.6: Uncertain, may need optimization
|
||||
- Score < 0.4: Likely problematic
|
||||
|
||||
**When to use:**
|
||||
- After initial NetSolP filtering
|
||||
- When higher prediction accuracy is needed
|
||||
- Before committing to expensive synthesis/testing
|
||||
|
||||
### SolubleMPNN - Sequence Redesign
|
||||
|
||||
**Purpose:** Redesign protein sequences to improve solubility while maintaining function.
|
||||
|
||||
**Method:** Graph neural network that suggests mutations to increase solubility.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Install: uv pip install soluble-mpnn
|
||||
from soluble_mpnn import optimize_sequence
|
||||
|
||||
def optimize_for_solubility(sequence, structure_pdb=None):
|
||||
"""
|
||||
Redesign sequence for improved solubility
|
||||
|
||||
Args:
|
||||
sequence: Original amino acid sequence
|
||||
structure_pdb: Optional PDB file for structure-aware design
|
||||
|
||||
Returns:
|
||||
Optimized sequence variants ranked by predicted solubility
|
||||
"""
|
||||
|
||||
variants = optimize_sequence(
|
||||
sequence=sequence,
|
||||
structure=structure_pdb,
|
||||
num_variants=10,
|
||||
temperature=0.1 # Lower = more conservative mutations
|
||||
)
|
||||
|
||||
return variants
|
||||
|
||||
# Example
|
||||
original_seq = "MKVLWAALLGLLGAAA..."
|
||||
optimized_variants = optimize_for_solubility(original_seq)
|
||||
|
||||
for i, variant in enumerate(optimized_variants):
|
||||
print(f"Variant {i+1}:")
|
||||
print(f" Sequence: {variant['sequence']}")
|
||||
print(f" Solubility score: {variant['solubility_score']}")
|
||||
print(f" Mutations: {variant['mutations']}")
|
||||
```
|
||||
|
||||
**Design strategy:**
|
||||
- **Conservative** (temperature=0.1): Minimal changes, safer
|
||||
- **Moderate** (temperature=0.3): Balance between change and safety
|
||||
- **Aggressive** (temperature=0.5): More mutations, higher risk
|
||||
|
||||
**When to use:**
|
||||
- Primary tool for sequence optimization
|
||||
- Default starting point for improving problematic sequences
|
||||
- Generating diverse soluble variants
|
||||
|
||||
**Best practices:**
|
||||
- Generate 10-50 variants per sequence
|
||||
- Use structure information when available (improves accuracy)
|
||||
- Validate key functional residues are preserved
|
||||
- Test multiple temperature settings
|
||||
|
||||
### ESM (Evolutionary Scale Modeling) - Sequence Likelihood
|
||||
|
||||
**Purpose:** Assess how "natural" a protein sequence appears based on evolutionary patterns.
|
||||
|
||||
**Method:** Protein language model trained on millions of natural sequences.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Install: uv pip install fair-esm
|
||||
import torch
|
||||
from esm import pretrained
|
||||
|
||||
def score_sequence_esm(sequence):
|
||||
"""
|
||||
Calculate ESM likelihood score for sequence
|
||||
Higher scores indicate more natural/stable sequences
|
||||
"""
|
||||
|
||||
model, alphabet = pretrained.esm2_t33_650M_UR50D()
|
||||
batch_converter = alphabet.get_batch_converter()
|
||||
|
||||
data = [("protein", sequence)]
|
||||
_, _, batch_tokens = batch_converter(data)
|
||||
|
||||
with torch.no_grad():
|
||||
results = model(batch_tokens, repr_layers=[33])
|
||||
token_logprobs = results["logits"].log_softmax(dim=-1)
|
||||
|
||||
# Calculate perplexity as sequence quality metric
|
||||
sequence_score = token_logprobs.mean().item()
|
||||
|
||||
return sequence_score
|
||||
|
||||
# Example - Compare variants
|
||||
sequences = {
|
||||
'original': 'MKVLW...',
|
||||
'optimized_1': 'MKVLS...',
|
||||
'optimized_2': 'MKVLA...'
|
||||
}
|
||||
|
||||
for name, seq in sequences.items():
|
||||
score = score_sequence_esm(seq)
|
||||
print(f"{name}: ESM score = {score:.3f}")
|
||||
```
|
||||
|
||||
**Interpretation:**
|
||||
- Higher scores → More "natural" sequence
|
||||
- Use to avoid unlikely mutations
|
||||
- Balance with functional requirements
|
||||
|
||||
**When to use:**
|
||||
- Filtering synthetic designs
|
||||
- Comparing SolubleMPNN variants
|
||||
- Ensuring sequences aren't too artificial
|
||||
- Avoiding expression bottlenecks
|
||||
|
||||
**Integration with design:**
|
||||
```python
|
||||
def rank_variants_by_esm(variants):
|
||||
"""Rank protein variants by ESM likelihood"""
|
||||
scored = []
|
||||
for v in variants:
|
||||
esm_score = score_sequence_esm(v['sequence'])
|
||||
v['esm_score'] = esm_score
|
||||
scored.append(v)
|
||||
|
||||
# Sort by combined solubility and ESM score
|
||||
scored.sort(
|
||||
key=lambda x: x['solubility_score'] * x['esm_score'],
|
||||
reverse=True
|
||||
)
|
||||
|
||||
return scored
|
||||
```
|
||||
|
||||
### ipTM - Interface Stability (AlphaFold-Multimer)
|
||||
|
||||
**Purpose:** Assess protein-protein interface stability and binding confidence.
|
||||
|
||||
**Method:** Interface predicted TM-score from AlphaFold-Multimer predictions.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Requires AlphaFold-Multimer installation
|
||||
# Or use ColabFold for easier access
|
||||
|
||||
def predict_interface_stability(protein_a_seq, protein_b_seq):
|
||||
"""
|
||||
Predict interface stability using AlphaFold-Multimer
|
||||
|
||||
Returns ipTM score: higher = more stable interface
|
||||
"""
|
||||
from colabfold import run_alphafold_multimer
|
||||
|
||||
sequences = {
|
||||
'chainA': protein_a_seq,
|
||||
'chainB': protein_b_seq
|
||||
}
|
||||
|
||||
result = run_alphafold_multimer(sequences)
|
||||
|
||||
return {
|
||||
'ipTM': result['iptm'],
|
||||
'pTM': result['ptm'],
|
||||
'pLDDT': result['plddt']
|
||||
}
|
||||
|
||||
# Example for antibody-antigen binding
|
||||
antibody_seq = "EVQLVESGGGLVQPGG..."
|
||||
antigen_seq = "MKVLWAALLGLLGAAA..."
|
||||
|
||||
stability = predict_interface_stability(antibody_seq, antigen_seq)
|
||||
print(f"Interface pTM: {stability['ipTM']:.3f}")
|
||||
|
||||
# Interpretation
|
||||
if stability['ipTM'] > 0.7:
|
||||
print("High confidence interface")
|
||||
elif stability['ipTM'] > 0.5:
|
||||
print("Moderate confidence interface")
|
||||
else:
|
||||
print("Low confidence interface - may need redesign")
|
||||
```
|
||||
|
||||
**Interpretation:**
|
||||
- ipTM > 0.7: Strong predicted interface
|
||||
- ipTM 0.5-0.7: Moderate interface confidence
|
||||
- ipTM < 0.5: Weak interface, consider redesign
|
||||
|
||||
**When to use:**
|
||||
- Antibody-antigen design
|
||||
- Protein-protein interaction engineering
|
||||
- Validating binding interfaces
|
||||
- Comparing interface variants
|
||||
|
||||
### pSAE - Solvent-Accessible Hydrophobic Residues
|
||||
|
||||
**Purpose:** Quantify exposed hydrophobic residues that promote aggregation.
|
||||
|
||||
**Method:** Calculates percentage of solvent-accessible surface area (SASA) occupied by hydrophobic residues.
|
||||
|
||||
**Usage:**
|
||||
```python
|
||||
# Requires structure (PDB file or AlphaFold prediction)
|
||||
# Install: uv pip install biopython
|
||||
|
||||
from Bio.PDB import PDBParser, DSSP
|
||||
import numpy as np
|
||||
|
||||
def calculate_psae(pdb_file):
|
||||
"""
|
||||
Calculate percent Solvent-Accessible hydrophobic residues (pSAE)
|
||||
|
||||
Lower pSAE = better solubility
|
||||
"""
|
||||
|
||||
parser = PDBParser(QUIET=True)
|
||||
structure = parser.get_structure('protein', pdb_file)
|
||||
|
||||
# Run DSSP to get solvent accessibility
|
||||
model = structure[0]
|
||||
dssp = DSSP(model, pdb_file, acc_array='Wilke')
|
||||
|
||||
hydrophobic = ['ALA', 'VAL', 'ILE', 'LEU', 'MET', 'PHE', 'TRP', 'PRO']
|
||||
|
||||
total_sasa = 0
|
||||
hydrophobic_sasa = 0
|
||||
|
||||
for residue in dssp:
|
||||
res_name = residue[1]
|
||||
rel_accessibility = residue[3]
|
||||
|
||||
total_sasa += rel_accessibility
|
||||
if res_name in hydrophobic:
|
||||
hydrophobic_sasa += rel_accessibility
|
||||
|
||||
psae = (hydrophobic_sasa / total_sasa) * 100
|
||||
|
||||
return psae
|
||||
|
||||
# Example
|
||||
pdb_file = "protein_structure.pdb"
|
||||
psae_score = calculate_psae(pdb_file)
|
||||
print(f"pSAE: {psae_score:.2f}%")
|
||||
|
||||
# Interpretation
|
||||
if psae_score < 25:
|
||||
print("Good solubility expected")
|
||||
elif psae_score < 35:
|
||||
print("Moderate solubility")
|
||||
else:
|
||||
print("High aggregation risk")
|
||||
```
|
||||
|
||||
**Interpretation:**
|
||||
- pSAE < 25%: Low aggregation risk
|
||||
- pSAE 25-35%: Moderate risk
|
||||
- pSAE > 35%: High aggregation risk
|
||||
|
||||
**When to use:**
|
||||
- Analyzing designed structures
|
||||
- Post-AlphaFold validation
|
||||
- Identifying aggregation hotspots
|
||||
- Guiding surface mutations
|
||||
|
||||
## Recommended Optimization Workflow
|
||||
|
||||
### Step 1: Initial Screening (Fast)
|
||||
|
||||
```python
|
||||
def initial_screening(sequences):
|
||||
"""
|
||||
Quick first-pass filtering using NetSolP
|
||||
Filters out obviously problematic sequences
|
||||
"""
|
||||
passed = []
|
||||
for name, seq in sequences.items():
|
||||
netsolp_score = predict_solubility_netsolp(seq)
|
||||
if netsolp_score > 0.5:
|
||||
passed.append((name, seq))
|
||||
|
||||
return passed
|
||||
```
|
||||
|
||||
### Step 2: Detailed Assessment (Moderate)
|
||||
|
||||
```python
|
||||
def detailed_assessment(filtered_sequences):
|
||||
"""
|
||||
More thorough analysis with SoluProt and ESM
|
||||
Ranks sequences by multiple criteria
|
||||
"""
|
||||
results = []
|
||||
for name, seq in filtered_sequences:
|
||||
soluprot_score = predict_solubility(seq)
|
||||
esm_score = score_sequence_esm(seq)
|
||||
|
||||
combined_score = soluprot_score * 0.7 + esm_score * 0.3
|
||||
|
||||
results.append({
|
||||
'name': name,
|
||||
'sequence': seq,
|
||||
'soluprot': soluprot_score,
|
||||
'esm': esm_score,
|
||||
'combined': combined_score
|
||||
})
|
||||
|
||||
results.sort(key=lambda x: x['combined'], reverse=True)
|
||||
return results
|
||||
```
|
||||
|
||||
### Step 3: Sequence Optimization (If needed)
|
||||
|
||||
```python
|
||||
def optimize_problematic_sequences(sequences_needing_optimization):
|
||||
"""
|
||||
Use SolubleMPNN to redesign problematic sequences
|
||||
Returns improved variants
|
||||
"""
|
||||
optimized = []
|
||||
for name, seq in sequences_needing_optimization:
|
||||
# Generate multiple variants
|
||||
variants = optimize_sequence(
|
||||
sequence=seq,
|
||||
num_variants=10,
|
||||
temperature=0.2
|
||||
)
|
||||
|
||||
# Score variants with ESM
|
||||
for variant in variants:
|
||||
variant['esm_score'] = score_sequence_esm(variant['sequence'])
|
||||
|
||||
# Keep best variants
|
||||
variants.sort(
|
||||
key=lambda x: x['solubility_score'] * x['esm_score'],
|
||||
reverse=True
|
||||
)
|
||||
|
||||
optimized.extend(variants[:3]) # Top 3 variants per sequence
|
||||
|
||||
return optimized
|
||||
```
|
||||
|
||||
### Step 4: Structure-Based Validation (For critical sequences)
|
||||
|
||||
```python
|
||||
def structure_validation(top_candidates):
|
||||
"""
|
||||
Predict structures and calculate pSAE for top candidates
|
||||
Final validation before experimental testing
|
||||
"""
|
||||
validated = []
|
||||
for candidate in top_candidates:
|
||||
# Predict structure with AlphaFold
|
||||
structure_pdb = predict_structure_alphafold(candidate['sequence'])
|
||||
|
||||
# Calculate pSAE
|
||||
psae = calculate_psae(structure_pdb)
|
||||
|
||||
candidate['psae'] = psae
|
||||
candidate['pass_structure_check'] = psae < 30
|
||||
|
||||
validated.append(candidate)
|
||||
|
||||
return validated
|
||||
```
|
||||
|
||||
### Complete Workflow Example
|
||||
|
||||
```python
|
||||
def complete_optimization_pipeline(initial_sequences):
|
||||
"""
|
||||
End-to-end optimization pipeline
|
||||
|
||||
Input: Dictionary of {name: sequence}
|
||||
Output: Ranked list of optimized, validated sequences
|
||||
"""
|
||||
|
||||
print("Step 1: Initial screening with NetSolP...")
|
||||
filtered = initial_screening(initial_sequences)
|
||||
print(f" Passed: {len(filtered)}/{len(initial_sequences)}")
|
||||
|
||||
print("Step 2: Detailed assessment with SoluProt and ESM...")
|
||||
assessed = detailed_assessment(filtered)
|
||||
|
||||
# Split into good and needs-optimization
|
||||
good_sequences = [s for s in assessed if s['soluprot'] > 0.6]
|
||||
needs_optimization = [s for s in assessed if s['soluprot'] <= 0.6]
|
||||
|
||||
print(f" Good sequences: {len(good_sequences)}")
|
||||
print(f" Need optimization: {len(needs_optimization)}")
|
||||
|
||||
if needs_optimization:
|
||||
print("Step 3: Optimizing problematic sequences with SolubleMPNN...")
|
||||
optimized = optimize_problematic_sequences(needs_optimization)
|
||||
all_sequences = good_sequences + optimized
|
||||
else:
|
||||
all_sequences = good_sequences
|
||||
|
||||
print("Step 4: Structure-based validation for top candidates...")
|
||||
top_20 = all_sequences[:20]
|
||||
final_validated = structure_validation(top_20)
|
||||
|
||||
# Final ranking
|
||||
final_validated.sort(
|
||||
key=lambda x: (
|
||||
x['pass_structure_check'],
|
||||
x['combined'],
|
||||
-x['psae']
|
||||
),
|
||||
reverse=True
|
||||
)
|
||||
|
||||
return final_validated
|
||||
|
||||
# Usage
|
||||
initial_library = {
|
||||
'variant_1': 'MKVLWAALLGLLGAAA...',
|
||||
'variant_2': 'MATGVLWAALLGLLGA...',
|
||||
# ... more sequences
|
||||
}
|
||||
|
||||
optimized_library = complete_optimization_pipeline(initial_library)
|
||||
|
||||
# Submit top sequences to Adaptyv
|
||||
top_sequences_for_testing = optimized_library[:50]
|
||||
```
|
||||
|
||||
## Best Practices Summary
|
||||
|
||||
1. **Always pre-screen** before experimental testing
|
||||
2. **Use NetSolP first** for fast filtering of large libraries
|
||||
3. **Apply SolubleMPNN** as default optimization tool
|
||||
4. **Validate with ESM** to avoid unnatural sequences
|
||||
5. **Calculate pSAE** for structure-based validation
|
||||
6. **Test multiple variants** per design to account for prediction uncertainty
|
||||
7. **Keep controls** - include wild-type or known-good sequences
|
||||
8. **Iterate** - use experimental results to refine predictions
|
||||
|
||||
## Integration with Adaptyv
|
||||
|
||||
After computational optimization, submit sequences to Adaptyv:
|
||||
|
||||
```python
|
||||
# After optimization pipeline
|
||||
optimized_sequences = complete_optimization_pipeline(initial_library)
|
||||
|
||||
# Prepare FASTA format
|
||||
fasta_content = ""
|
||||
for seq_data in optimized_sequences[:50]: # Top 50
|
||||
fasta_content += f">{seq_data['name']}\n{seq_data['sequence']}\n"
|
||||
|
||||
# Submit to Adaptyv
|
||||
import requests
|
||||
response = requests.post(
|
||||
"https://kq5jp7qj7wdqklhsxmovkzn4l40obksv.lambda-url.eu-central-1.on.aws/experiments",
|
||||
headers={"Authorization": f"Bearer {api_key}"},
|
||||
json={
|
||||
"sequences": fasta_content,
|
||||
"experiment_type": "expression",
|
||||
"metadata": {
|
||||
"optimization_method": "SolubleMPNN_ESM_pipeline",
|
||||
"computational_scores": [s['combined'] for s in optimized_sequences[:50]]
|
||||
}
|
||||
}
|
||||
)
|
||||
```
|
||||
|
||||
## Troubleshooting
|
||||
|
||||
**Issue: All sequences score poorly on solubility predictions**
|
||||
- Check if sequences contain unusual amino acids
|
||||
- Verify FASTA format is correct
|
||||
- Consider if protein family is naturally low-solubility
|
||||
- May need experimental validation despite predictions
|
||||
|
||||
**Issue: SolubleMPNN changes functionally important residues**
|
||||
- Provide structure file to preserve spatial constraints
|
||||
- Mask critical residues from mutation
|
||||
- Lower temperature parameter for conservative changes
|
||||
- Manually revert problematic mutations
|
||||
|
||||
**Issue: ESM scores are low after optimization**
|
||||
- Optimization may be too aggressive
|
||||
- Try lower temperature in SolubleMPNN
|
||||
- Balance between solubility and naturalness
|
||||
- Consider that some optimization may require non-natural mutations
|
||||
|
||||
**Issue: Predictions don't match experimental results**
|
||||
- Predictions are probabilistic, not deterministic
|
||||
- Host system and conditions affect expression
|
||||
- Some proteins may need experimental validation
|
||||
- Use predictions as enrichment, not absolute filters
|
||||
Reference in New Issue
Block a user