--- name: pyopenms description: "Mass spectrometry toolkit (OpenMS Python). Process mzML/mzXML, peak picking, feature detection, peptide ID, proteomics/metabolomics workflows, for LC-MS/MS analysis." --- # pyOpenMS ## Overview pyOpenMS is an open-source Python library providing comprehensive tools for mass spectrometry data analysis in proteomics and metabolomics research. It offers Python bindings to the OpenMS C++ library, enabling efficient processing of LC-MS/MS data, peptide identification, feature detection, quantification, and integration with common proteomics tools like Comet, Mascot, MSGF+, Percolator, and MSstats. Use this skill when working with mass spectrometry data analysis tasks, processing proteomics or metabolomics datasets, or implementing computational workflows for biomolecular identification and quantification. ## Core Capabilities ### 1. File I/O and Data Import/Export Handle diverse mass spectrometry file formats efficiently: **Supported Formats:** - **mzML/mzXML**: Primary raw MS data formats (profile or centroid) - **FASTA**: Protein/peptide sequence databases - **mzTab**: Standardized reporting format for identification and quantification - **mzIdentML**: Peptide and protein identification data - **TraML**: Transition lists for targeted experiments - **pepXML/protXML**: Search engine results **Reading mzML Files:** ```python import pyopenms as oms # Load MS data exp = oms.MSExperiment() oms.MzMLFile().load("input_data.mzML", exp) # Access basic information print(f"Number of spectra: {exp.getNrSpectra()}") print(f"Number of chromatograms: {exp.getNrChromatograms()}") ``` **Writing mzML Files:** ```python # Save processed data oms.MzMLFile().store("output_data.mzML", exp) ``` **File Encoding:** pyOpenMS automatically handles Base64 encoding, zlib compression, and Numpress compression internally. ### 2. MS Data Structures and Manipulation Work with core mass spectrometry data structures. See `references/data_structures.md` for comprehensive details. **MSSpectrum** - Individual mass spectrum: ```python # Create spectrum with metadata spectrum = oms.MSSpectrum() spectrum.setRT(205.2) # Retention time in seconds spectrum.setMSLevel(2) # MS2 spectrum # Set peak data (m/z, intensity arrays) mz_array = [100.5, 200.3, 300.7, 400.2] intensity_array = [1000, 5000, 3000, 2000] spectrum.set_peaks((mz_array, intensity_array)) # Add precursor information for MS2 precursor = oms.Precursor() precursor.setMZ(450.5) precursor.setCharge(2) spectrum.setPrecursors([precursor]) ``` **MSExperiment** - Complete LC-MS/MS run: ```python # Create experiment and add spectra exp = oms.MSExperiment() exp.addSpectrum(spectrum) # Access spectra first_spectrum = exp.getSpectrum(0) for spec in exp: print(f"RT: {spec.getRT()}, MS Level: {spec.getMSLevel()}") ``` **MSChromatogram** - Extracted ion chromatogram: ```python # Create chromatogram chrom = oms.MSChromatogram() chrom.set_peaks(([10.5, 11.2, 11.8], [1000, 5000, 3000])) # RT, intensity exp.addChromatogram(chrom) ``` **Efficient Peak Access:** ```python # Get peaks as numpy arrays for fast processing mz_array, intensity_array = spectrum.get_peaks() # Modify and set back intensity_array *= 2 # Double all intensities spectrum.set_peaks((mz_array, intensity_array)) ``` ### 3. Chemistry and Peptide Handling Perform chemical calculations for proteomics and metabolomics. See `references/chemistry.md` for detailed examples. **Molecular Formulas and Mass Calculations:** ```python # Create empirical formula formula = oms.EmpiricalFormula("C6H12O6") # Glucose print(f"Monoisotopic mass: {formula.getMonoWeight()}") print(f"Average mass: {formula.getAverageWeight()}") # Formula arithmetic water = oms.EmpiricalFormula("H2O") dehydrated = formula - water # Isotope-specific formulas heavy_carbon = oms.EmpiricalFormula("(13)C6H12O6") ``` **Isotopic Distributions:** ```python # Generate coarse isotope pattern (unit mass resolution) coarse_gen = oms.CoarseIsotopePatternGenerator() pattern = coarse_gen.run(formula) # Generate fine structure (high resolution) fine_gen = oms.FineIsotopePatternGenerator(0.01) # 0.01 Da resolution fine_pattern = fine_gen.run(formula) ``` **Amino Acids and Residues:** ```python # Access residue information res_db = oms.ResidueDB() leucine = res_db.getResidue("Leucine") print(f"L monoisotopic mass: {leucine.getMonoWeight()}") print(f"L formula: {leucine.getFormula()}") print(f"L pKa: {leucine.getPka()}") ``` **Peptide Sequences:** ```python # Create peptide sequence peptide = oms.AASequence.fromString("PEPTIDE") print(f"Peptide mass: {peptide.getMonoWeight()}") print(f"Formula: {peptide.getFormula()}") # Add modifications modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)") print(f"Modified mass: {modified.getMonoWeight()}") # Theoretical fragmentation ions = [] for i in range(1, peptide.size()): b_ion = peptide.getPrefix(i) y_ion = peptide.getSuffix(i) ions.append(('b', i, b_ion.getMonoWeight())) ions.append(('y', i, y_ion.getMonoWeight())) ``` **Protein Digestion:** ```python # Enzymatic digestion dig = oms.ProteaseDigestion() dig.setEnzyme("Trypsin") dig.setMissedCleavages(2) protein_seq = oms.AASequence.fromString("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK") peptides = [] dig.digest(protein_seq, peptides) for pep in peptides: print(f"{pep.toString()}: {pep.getMonoWeight():.2f} Da") ``` **Modifications:** ```python # Access modification database mod_db = oms.ModificationsDB() oxidation = mod_db.getModification("Oxidation") print(f"Oxidation mass diff: {oxidation.getDiffMonoMass()}") print(f"Residues: {oxidation.getResidues()}") ``` ### 4. Signal Processing and Filtering Apply algorithms to process and filter MS data. See `references/algorithms.md` for comprehensive coverage. **Spectral Smoothing:** ```python # Gaussian smoothing gauss_filter = oms.GaussFilter() params = gauss_filter.getParameters() params.setValue("gaussian_width", 0.2) gauss_filter.setParameters(params) gauss_filter.filterExperiment(exp) # Savitzky-Golay filter sg_filter = oms.SavitzkyGolayFilter() sg_filter.filterExperiment(exp) ``` **Peak Filtering:** ```python # Keep only N largest peaks per spectrum n_largest = oms.NLargest() params = n_largest.getParameters() params.setValue("n", 100) # Keep top 100 peaks n_largest.setParameters(params) n_largest.filterExperiment(exp) # Threshold filtering threshold_filter = oms.ThresholdMower() params = threshold_filter.getParameters() params.setValue("threshold", 1000.0) # Remove peaks below 1000 intensity threshold_filter.setParameters(params) threshold_filter.filterExperiment(exp) # Window-based filtering window_filter = oms.WindowMower() params = window_filter.getParameters() params.setValue("windowsize", 50.0) # 50 m/z windows params.setValue("peakcount", 10) # Keep 10 highest per window window_filter.setParameters(params) window_filter.filterExperiment(exp) ``` **Spectrum Normalization:** ```python normalizer = oms.Normalizer() normalizer.filterExperiment(exp) ``` **MS Level Filtering:** ```python # Keep only MS2 spectra exp.filterMSLevel(2) # Filter by retention time range exp.filterRT(100.0, 500.0) # Keep RT between 100-500 seconds # Filter by m/z range exp.filterMZ(400.0, 1500.0) # Keep m/z between 400-1500 ``` ### 5. Feature Detection and Quantification Detect and quantify features in LC-MS data: **Peak Picking (Centroiding):** ```python # Convert profile data to centroid picker = oms.PeakPickerHiRes() params = picker.getParameters() params.setValue("signal_to_noise", 1.0) picker.setParameters(params) exp_centroided = oms.MSExperiment() picker.pickExperiment(exp, exp_centroided) ``` **Feature Detection:** ```python # Detect features across LC-MS runs feature_finder = oms.FeatureFinderMultiplex() features = oms.FeatureMap() feature_finder.run(exp, features, params) print(f"Found {features.size()} features") for feature in features: print(f"m/z: {feature.getMZ():.4f}, RT: {feature.getRT():.2f}, " f"Intensity: {feature.getIntensity():.0f}") ``` **Feature Linking (Map Alignment):** ```python # Link features across multiple samples feature_grouper = oms.FeatureGroupingAlgorithmQT() consensus_map = oms.ConsensusMap() # Provide multiple feature maps from different samples feature_maps = [features1, features2, features3] feature_grouper.group(feature_maps, consensus_map) ``` ### 6. Peptide Identification Workflows Integrate with search engines and process identification results: **Database Searching:** ```python # Prepare parameters for search engine params = oms.Param() params.setValue("database", "uniprot_human.fasta") params.setValue("precursor_mass_tolerance", 10.0) # ppm params.setValue("fragment_mass_tolerance", 0.5) # Da params.setValue("enzyme", "Trypsin") params.setValue("missed_cleavages", 2) # Variable modifications params.setValue("variable_modifications", ["Oxidation (M)", "Phospho (STY)"]) # Fixed modifications params.setValue("fixed_modifications", ["Carbamidomethyl (C)"]) ``` **FDR Control:** ```python # False discovery rate estimation fdr = oms.FalseDiscoveryRate() fdr_threshold = 0.01 # 1% FDR # Apply to peptide identifications protein_ids = [] peptide_ids = [] oms.IdXMLFile().load("search_results.idXML", protein_ids, peptide_ids) fdr.apply(protein_ids, peptide_ids) ``` ### 7. Metabolomics Workflows Analyze small molecule data: **Adduct Detection:** ```python # Common metabolite adducts adducts = ["[M+H]+", "[M+Na]+", "[M+K]+", "[M-H]-", "[M+Cl]-"] # Feature annotation with adducts for feature in features: mz = feature.getMZ() # Calculate neutral mass for each adduct hypothesis for adduct in adducts: # Annotation logic pass ``` **Isotope Pattern Matching:** ```python # Compare experimental to theoretical isotope patterns experimental_pattern = [] # Extract from feature theoretical = coarse_gen.run(formula) # Calculate similarity score similarity = compare_isotope_patterns(experimental_pattern, theoretical) ``` ### 8. Quality Control and Visualization Monitor data quality and visualize results: **Basic Statistics:** ```python # Calculate TIC (Total Ion Current) tic_values = [] rt_values = [] for spectrum in exp: if spectrum.getMSLevel() == 1: tic = sum(spectrum.get_peaks()[1]) # Sum intensities tic_values.append(tic) rt_values.append(spectrum.getRT()) # Base peak chromatogram bpc_values = [] for spectrum in exp: if spectrum.getMSLevel() == 1: max_intensity = max(spectrum.get_peaks()[1]) if spectrum.size() > 0 else 0 bpc_values.append(max_intensity) ``` **Plotting (with pyopenms.plotting or matplotlib):** ```python import matplotlib.pyplot as plt # Plot TIC plt.figure(figsize=(10, 4)) plt.plot(rt_values, tic_values) plt.xlabel('Retention Time (s)') plt.ylabel('Total Ion Current') plt.title('TIC') plt.show() # Plot single spectrum spectrum = exp.getSpectrum(0) mz, intensity = spectrum.get_peaks() plt.stem(mz, intensity, basefmt=' ') plt.xlabel('m/z') plt.ylabel('Intensity') plt.title(f'Spectrum at RT {spectrum.getRT():.2f}s') plt.show() ``` ## Common Workflows ### Complete LC-MS/MS Processing Pipeline ```python import pyopenms as oms # 1. Load data exp = oms.MSExperiment() oms.MzMLFile().load("raw_data.mzML", exp) # 2. Filter and smooth exp.filterMSLevel(1) # Keep only MS1 for feature detection gauss = oms.GaussFilter() gauss.filterExperiment(exp) # 3. Peak picking picker = oms.PeakPickerHiRes() exp_centroid = oms.MSExperiment() picker.pickExperiment(exp, exp_centroid) # 4. Feature detection ff = oms.FeatureFinderMultiplex() features = oms.FeatureMap() ff.run(exp_centroid, features, oms.Param()) # 5. Export results oms.FeatureXMLFile().store("features.featureXML", features) print(f"Detected {features.size()} features") ``` ### Theoretical Peptide Mass Calculation ```python # Calculate masses for peptide with modifications peptide = oms.AASequence.fromString("PEPTIDEK") print(f"Unmodified [M+H]+: {peptide.getMonoWeight() + 1.007276:.4f}") # With modification modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)K") print(f"Oxidized [M+H]+: {modified.getMonoWeight() + 1.007276:.4f}") # Calculate for different charge states for z in [1, 2, 3]: mz = (peptide.getMonoWeight() + z * 1.007276) / z print(f"[M+{z}H]^{z}+: {mz:.4f}") ``` ## Installation Ensure pyOpenMS is installed before using this skill: ```bash # Via conda (recommended) conda install -c bioconda pyopenms # Via pip pip install pyopenms ``` ## Integration with Other Tools pyOpenMS integrates seamlessly with: - **Search Engines**: Comet, Mascot, MSGF+, MSFragger, Sage, SpectraST - **Post-processing**: Percolator, MSstats, Epiphany - **Metabolomics**: SIRIUS, CSI:FingerID - **Data Analysis**: Pandas, NumPy, SciPy for downstream analysis - **Visualization**: Matplotlib, Seaborn for plotting ## Resources ### references/ Detailed documentation on core concepts: - **data_structures.md** - Comprehensive guide to MSExperiment, MSSpectrum, MSChromatogram, and peak data handling - **algorithms.md** - Complete reference for signal processing, filtering, feature detection, and quantification algorithms - **chemistry.md** - In-depth coverage of chemistry calculations, peptide handling, modifications, and isotope distributions Load these references when needing detailed information about specific pyOpenMS capabilities. ## Best Practices 1. **File Format**: Always use mzML for raw MS data (standardized, well-supported) 2. **Peak Access**: Use `get_peaks()` and `set_peaks()` with numpy arrays for efficient processing 3. **Parameters**: Always check and configure algorithm parameters via `getParameters()` and `setParameters()` 4. **Memory**: For large datasets, process spectra iteratively rather than loading entire experiments 5. **Validation**: Check data integrity (MS levels, RT ordering, precursor information) after loading 6. **Modifications**: Use standard modification names from UniMod database 7. **Units**: RT in seconds, m/z in Thomson (Da/charge), intensity in arbitrary units ## Common Patterns **Algorithm Application Pattern:** ```python # 1. Instantiate algorithm algorithm = oms.SomeAlgorithm() # 2. Get and configure parameters params = algorithm.getParameters() params.setValue("parameter_name", value) algorithm.setParameters(params) # 3. Apply to data algorithm.filterExperiment(exp) # or .process(), .run(), depending on algorithm ``` **File I/O Pattern:** ```python # Read data_container = oms.DataContainer() # MSExperiment, FeatureMap, etc. oms.FileHandler().load("input.format", data_container) # Process # ... manipulate data_container ... # Write oms.FileHandler().store("output.format", data_container) ``` ## Getting Help - **Documentation**: https://pyopenms.readthedocs.io/ - **API Reference**: Browse class documentation for detailed method signatures - **OpenMS Website**: https://www.openms.org/ - **GitHub Issues**: https://github.com/OpenMS/OpenMS/issues