mirror of
https://github.com/K-Dense-AI/claude-scientific-skills.git
synced 2026-03-28 07:33:45 +08:00
18 KiB
18 KiB
pyOpenMS Chemistry Reference
This document provides comprehensive coverage of chemistry-related functionality in pyOpenMS, including elements, isotopes, molecular formulas, amino acids, peptides, proteins, and modifications.
Elements and Isotopes
ElementDB - Element Database
Access atomic and isotopic data for all elements.
import pyopenms as oms
# Get element database instance
element_db = oms.ElementDB()
# Get element by symbol
carbon = element_db.getElement("C")
nitrogen = element_db.getElement("N")
oxygen = element_db.getElement("O")
# Element properties
print(f"Carbon monoisotopic weight: {carbon.getMonoWeight()}")
print(f"Carbon average weight: {carbon.getAverageWeight()}")
print(f"Atomic number: {carbon.getAtomicNumber()}")
print(f"Symbol: {carbon.getSymbol()}")
print(f"Name: {carbon.getName()}")
Isotope Information
# Get isotope distribution for an element
isotopes = carbon.getIsotopeDistribution()
# Access specific isotope
c12 = element_db.getElement("C", 12) # Carbon-12
c13 = element_db.getElement("C", 13) # Carbon-13
print(f"C-12 abundance: {isotopes.getContainer()[0].getIntensity()}")
print(f"C-13 abundance: {isotopes.getContainer()[1].getIntensity()}")
# Isotope mass
print(f"C-12 mass: {c12.getMonoWeight()}")
print(f"C-13 mass: {c13.getMonoWeight()}")
Constants
# Physical constants
avogadro = oms.Constants.AVOGADRO
electron_mass = oms.Constants.ELECTRON_MASS_U
proton_mass = oms.Constants.PROTON_MASS_U
print(f"Avogadro's number: {avogadro}")
print(f"Electron mass: {electron_mass} u")
print(f"Proton mass: {proton_mass} u")
Empirical Formulas
EmpiricalFormula - Molecular Formulas
Represent and manipulate molecular formulas.
Creating Formulas
# From string
glucose = oms.EmpiricalFormula("C6H12O6")
water = oms.EmpiricalFormula("H2O")
ammonia = oms.EmpiricalFormula("NH3")
# From element composition
formula = oms.EmpiricalFormula()
formula.setCharge(1) # Set charge state
Formula Arithmetic
# Addition
sucrose = oms.EmpiricalFormula("C12H22O11")
hydrolyzed = sucrose + water # Hydrolysis adds water
# Subtraction
dehydrated = glucose - water # Dehydration removes water
# Multiplication
three_waters = water * 3 # 3 H2O = H6O3
# Division
formula_half = sucrose / 2 # Half the formula
Mass Calculations
# Monoisotopic mass
mono_mass = glucose.getMonoWeight()
print(f"Glucose monoisotopic mass: {mono_mass:.6f} Da")
# Average mass
avg_mass = glucose.getAverageWeight()
print(f"Glucose average mass: {avg_mass:.6f} Da")
# Mass difference
mass_diff = (glucose - water).getMonoWeight()
Elemental Composition
# Get element counts
formula = oms.EmpiricalFormula("C6H12O6")
# Access individual elements
n_carbon = formula.getNumberOf(element_db.getElement("C"))
n_hydrogen = formula.getNumberOf(element_db.getElement("H"))
n_oxygen = formula.getNumberOf(element_db.getElement("O"))
print(f"C: {n_carbon}, H: {n_hydrogen}, O: {n_oxygen}")
# String representation
print(f"Formula: {formula.toString()}")
Isotope-Specific Formulas
# Specify specific isotopes using parentheses
labeled_glucose = oms.EmpiricalFormula("(13)C6H12O6") # All carbons are C-13
partially_labeled = oms.EmpiricalFormula("C5(13)CH12O6") # One C-13
# Deuterium labeling
deuterated = oms.EmpiricalFormula("C6D12O6") # D2O instead of H2O
Charge States
# Set charge
formula = oms.EmpiricalFormula("C6H12O6")
formula.setCharge(1) # Positive charge
# Get charge
charge = formula.getCharge()
# Calculate m/z for charged molecule
mz = formula.getMonoWeight() / abs(charge) if charge != 0 else formula.getMonoWeight()
Isotope Pattern Generation
Generate theoretical isotope patterns for formulas.
CoarseIsotopePatternGenerator
For unit mass resolution (low-resolution instruments).
# Create generator
coarse_gen = oms.CoarseIsotopePatternGenerator()
# Generate pattern
formula = oms.EmpiricalFormula("C6H12O6")
pattern = coarse_gen.run(formula)
# Access isotope peaks
iso_dist = pattern.getContainer()
for peak in iso_dist:
mass = peak.getMZ()
abundance = peak.getIntensity()
print(f"m/z: {mass:.4f}, Abundance: {abundance:.4f}")
FineIsotopePatternGenerator
For high-resolution instruments (hyperfine structure).
# Create generator with resolution
fine_gen = oms.FineIsotopePatternGenerator(0.01) # 0.01 Da resolution
# Generate fine pattern
fine_pattern = fine_gen.run(formula)
# Access fine isotope structure
for peak in fine_pattern.getContainer():
print(f"m/z: {peak.getMZ():.6f}, Abundance: {peak.getIntensity():.6f}")
Isotope Pattern Matching
# Compare experimental to theoretical
def compare_isotope_patterns(experimental_mz, experimental_int, formula):
# Generate theoretical
coarse_gen = oms.CoarseIsotopePatternGenerator()
theoretical = coarse_gen.run(formula)
# Extract theoretical peaks
theo_peaks = theoretical.getContainer()
theo_mz = [p.getMZ() for p in theo_peaks]
theo_int = [p.getIntensity() for p in theo_peaks]
# Normalize both patterns
exp_int_norm = [i / max(experimental_int) for i in experimental_int]
theo_int_norm = [i / max(theo_int) for i in theo_int]
# Calculate similarity (e.g., cosine similarity)
# ... implement similarity calculation
return similarity_score
Amino Acids and Residues
Residue - Amino Acid Representation
Access properties of amino acids.
# Get residue database
res_db = oms.ResidueDB()
# Get specific residue
leucine = res_db.getResidue("Leucine")
# Or by one-letter code
leu = res_db.getResidue("L")
# Residue properties
print(f"Name: {leucine.getName()}")
print(f"Three-letter code: {leucine.getThreeLetterCode()}")
print(f"One-letter code: {leucine.getOneLetterCode()}")
print(f"Monoisotopic mass: {leucine.getMonoWeight():.6f}")
print(f"Average mass: {leucine.getAverageWeight():.6f}")
# Chemical formula
formula = leucine.getFormula()
print(f"Formula: {formula.toString()}")
# pKa values
print(f"pKa (N-term): {leucine.getPka()}")
print(f"pKa (C-term): {leucine.getPkb()}")
print(f"pKa (side chain): {leucine.getPkc()}")
# Side chain basicity/acidity
print(f"Basicity: {leucine.getBasicity()}")
print(f"Hydrophobicity: {leucine.getHydrophobicity()}")
All Standard Amino Acids
# Iterate over all residues
for residue_name in ["Alanine", "Cysteine", "Aspartic acid", "Glutamic acid",
"Phenylalanine", "Glycine", "Histidine", "Isoleucine",
"Lysine", "Leucine", "Methionine", "Asparagine",
"Proline", "Glutamine", "Arginine", "Serine",
"Threonine", "Valine", "Tryptophan", "Tyrosine"]:
res = res_db.getResidue(residue_name)
print(f"{res.getOneLetterCode()}: {res.getMonoWeight():.4f} Da")
Internal Residues vs. Termini
# Get internal residue mass (no terminal groups)
internal_mass = leucine.getInternalToFull()
# Get residue with N-terminal modification
n_terminal = res_db.getResidue("L[1]") # With NH2
# Get residue with C-terminal modification
c_terminal = res_db.getResidue("L[2]") # With COOH
Peptide Sequences
AASequence - Amino Acid Sequences
Represent and manipulate peptide sequences.
Creating Sequences
# From string
peptide = oms.AASequence.fromString("PEPTIDE")
longer = oms.AASequence.fromString("MKTAYIAKQRQISFVK")
# Empty sequence
empty_seq = oms.AASequence()
Sequence Properties
peptide = oms.AASequence.fromString("PEPTIDE")
# Length
length = peptide.size()
print(f"Length: {length} residues")
# Mass
mono_mass = peptide.getMonoWeight()
avg_mass = peptide.getAverageWeight()
print(f"Monoisotopic mass: {mono_mass:.6f} Da")
print(f"Average mass: {avg_mass:.6f} Da")
# Formula
formula = peptide.getFormula()
print(f"Formula: {formula.toString()}")
# String representation
seq_str = peptide.toString()
print(f"Sequence: {seq_str}")
Accessing Individual Residues
peptide = oms.AASequence.fromString("PEPTIDE")
# Access by index
first_aa = peptide[0] # Returns Residue object
print(f"First amino acid: {first_aa.getOneLetterCode()}")
# Iterate
for i in range(peptide.size()):
residue = peptide[i]
print(f"Position {i}: {residue.getOneLetterCode()}")
Modifications
Add post-translational modifications (PTMs) to sequences.
# Modifications in sequence string
# Format: AA(ModificationName)
oxidized_met = oms.AASequence.fromString("PEPTIDEM(Oxidation)")
phospho = oms.AASequence.fromString("PEPTIDES(Phospho)T(Phospho)")
# Multiple modifications
multi_mod = oms.AASequence.fromString("M(Oxidation)PEPTIDEK(Acetyl)")
# N-terminal modifications
n_term_acetyl = oms.AASequence.fromString("(Acetyl)PEPTIDE")
# C-terminal modifications
c_term_amide = oms.AASequence.fromString("PEPTIDE(Amidated)")
# Check mass change
unmodified = oms.AASequence.fromString("PEPTIDE")
modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)")
mass_diff = modified.getMonoWeight() - unmodified.getMonoWeight()
print(f"Mass shift from oxidation: {mass_diff:.6f} Da")
Sequence Manipulation
# Prefix (N-terminal fragment)
prefix = peptide.getPrefix(3) # First 3 residues
print(f"Prefix: {prefix.toString()}")
# Suffix (C-terminal fragment)
suffix = peptide.getSuffix(3) # Last 3 residues
print(f"Suffix: {suffix.toString()}")
# Subsequence
subseq = peptide.getSubsequence(2, 4) # Residues 2-4
print(f"Subsequence: {subseq.toString()}")
Theoretical Fragmentation
Generate theoretical fragment ions for MS/MS.
peptide = oms.AASequence.fromString("PEPTIDE")
# b-ions (N-terminal fragments)
b_ions = []
for i in range(1, peptide.size()):
b_fragment = peptide.getPrefix(i)
b_mass = b_fragment.getMonoWeight()
b_ions.append(('b', i, b_mass))
print(f"b{i}: {b_mass:.4f}")
# y-ions (C-terminal fragments)
y_ions = []
for i in range(1, peptide.size()):
y_fragment = peptide.getSuffix(i)
y_mass = y_fragment.getMonoWeight()
y_ions.append(('y', i, y_mass))
print(f"y{i}: {y_mass:.4f}")
# a-ions (b - CO)
a_ions = []
CO_mass = 27.994915 # CO loss
for ion_type, position, mass in b_ions:
a_mass = mass - CO_mass
a_ions.append(('a', position, a_mass))
# c-ions (b + NH3)
NH3_mass = 17.026549 # NH3 gain
c_ions = []
for ion_type, position, mass in b_ions:
c_mass = mass + NH3_mass
c_ions.append(('c', position, c_mass))
# z-ions (y - NH3)
z_ions = []
for ion_type, position, mass in y_ions:
z_mass = mass - NH3_mass
z_ions.append(('z', position, z_mass))
Calculate m/z for Charge States
peptide = oms.AASequence.fromString("PEPTIDE")
proton_mass = 1.007276
# [M+H]+
mz_1 = peptide.getMonoWeight() + proton_mass
print(f"[M+H]+: {mz_1:.4f}")
# [M+2H]2+
mz_2 = (peptide.getMonoWeight() + 2 * proton_mass) / 2
print(f"[M+2H]2+: {mz_2:.4f}")
# [M+3H]3+
mz_3 = (peptide.getMonoWeight() + 3 * proton_mass) / 3
print(f"[M+3H]3+: {mz_3:.4f}")
# General formula for any charge
def calculate_mz(sequence, charge):
proton_mass = 1.007276
return (sequence.getMonoWeight() + charge * proton_mass) / charge
for z in range(1, 5):
print(f"[M+{z}H]{z}+: {calculate_mz(peptide, z):.4f}")
Protein Digestion
ProteaseDigestion - Enzymatic Cleavage
Simulate enzymatic protein digestion.
Basic Digestion
# Create digestion object
dig = oms.ProteaseDigestion()
# Set enzyme
dig.setEnzyme("Trypsin") # Cleaves after K, R
# Other common enzymes:
# - "Trypsin" (K, R)
# - "Lys-C" (K)
# - "Arg-C" (R)
# - "Asp-N" (D)
# - "Glu-C" (E, D)
# - "Chymotrypsin" (F, Y, W, L)
# Set missed cleavages
dig.setMissedCleavages(0) # No missed cleavages
dig.setMissedCleavages(2) # Allow up to 2 missed cleavages
# Perform digestion
protein = oms.AASequence.fromString("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK")
peptides = []
dig.digest(protein, peptides)
# Print results
for pep in peptides:
print(f"{pep.toString()}: {pep.getMonoWeight():.2f} Da")
Advanced Digestion Options
# Get enzyme specificity
specificity = dig.getSpecificity()
# oms.EnzymaticDigestion.SPEC_FULL (both termini)
# oms.EnzymaticDigestion.SPEC_SEMI (one terminus)
# oms.EnzymaticDigestion.SPEC_NONE (no specificity)
# Set specificity for semi-tryptic search
dig.setSpecificity(oms.EnzymaticDigestion.SPEC_SEMI)
# Get cleavage sites
cleavage_residues = dig.getEnzyme().getCutAfterResidues()
restriction_residues = dig.getEnzyme().getRestriction()
Filter Peptides by Properties
# Filter by mass range
min_mass = 600.0
max_mass = 4000.0
filtered = [p for p in peptides if min_mass <= p.getMonoWeight() <= max_mass]
# Filter by length
min_length = 6
max_length = 30
length_filtered = [p for p in peptides if min_length <= p.size() <= max_length]
# Combine filters
valid_peptides = [p for p in peptides
if min_mass <= p.getMonoWeight() <= max_mass
and min_length <= p.size() <= max_length]
Modifications
ModificationsDB - Modification Database
Access and apply post-translational modifications.
Accessing Modifications
# Get modifications database
mod_db = oms.ModificationsDB()
# Get specific modification
oxidation = mod_db.getModification("Oxidation")
phospho = mod_db.getModification("Phospho")
acetyl = mod_db.getModification("Acetyl")
# Modification properties
print(f"Name: {oxidation.getFullName()}")
print(f"Mass difference: {oxidation.getDiffMonoMass():.6f} Da")
print(f"Formula: {oxidation.getDiffFormula().toString()}")
# Affected residues
print(f"Residues: {oxidation.getResidues()}") # e.g., ['M']
# Specificity (N-term, C-term, anywhere)
print(f"Term specificity: {oxidation.getTermSpecificity()}")
Common Modifications
# Oxidation (M)
oxidation = mod_db.getModification("Oxidation")
print(f"Oxidation: +{oxidation.getDiffMonoMass():.4f} Da")
# Phosphorylation (S, T, Y)
phospho = mod_db.getModification("Phospho")
print(f"Phospho: +{phospho.getDiffMonoMass():.4f} Da")
# Carbamidomethylation (C) - common alkylation
carbamido = mod_db.getModification("Carbamidomethyl")
print(f"Carbamidomethyl: +{carbamido.getDiffMonoMass():.4f} Da")
# Acetylation (K, N-term)
acetyl = mod_db.getModification("Acetyl")
print(f"Acetyl: +{acetyl.getDiffMonoMass():.4f} Da")
# Deamidation (N, Q)
deamid = mod_db.getModification("Deamidated")
print(f"Deamidation: +{deamid.getDiffMonoMass():.4f} Da")
Searching Modifications
# Search modifications by mass
mass_tolerance = 0.01 # Da
target_mass = 15.9949 # Oxidation
# Get all modifications
all_mods = []
mod_db.getAllSearchModifications(all_mods)
# Find matching modifications
matching = []
for mod_name in all_mods:
mod = mod_db.getModification(mod_name)
if abs(mod.getDiffMonoMass() - target_mass) < mass_tolerance:
matching.append(mod)
print(f"Match: {mod.getFullName()} ({mod.getDiffMonoMass():.4f} Da)")
Variable vs. Fixed Modifications
# In search engines, specify:
# Fixed modifications: applied to all occurrences
fixed_mods = ["Carbamidomethyl (C)"]
# Variable modifications: optionally present
variable_mods = ["Oxidation (M)", "Phospho (S)", "Phospho (T)", "Phospho (Y)"]
Ribonucleotides (RNA)
Ribonucleotide - RNA Building Blocks
# Get ribonucleotide database
ribo_db = oms.RibonucleotideDB()
# Get specific ribonucleotide
adenine = ribo_db.getRibonucleotide("A")
uracil = ribo_db.getRibonucleotide("U")
guanine = ribo_db.getRibonucleotide("G")
cytosine = ribo_db.getRibonucleotide("C")
# Properties
print(f"Adenine mono mass: {adenine.getMonoWeight()}")
print(f"Formula: {adenine.getFormula().toString()}")
# Modified ribonucleotides
modified_ribo = ribo_db.getRibonucleotide("m6A") # N6-methyladenosine
Practical Examples
Calculate Peptide Mass with Modifications
def calculate_peptide_mz(sequence_str, charge):
"""Calculate m/z for a peptide sequence string with modifications."""
peptide = oms.AASequence.fromString(sequence_str)
proton_mass = 1.007276
mz = (peptide.getMonoWeight() + charge * proton_mass) / charge
return mz
# Examples
print(calculate_peptide_mz("PEPTIDE", 2)) # Unmodified [M+2H]2+
print(calculate_peptide_mz("PEPTIDEM(Oxidation)", 2)) # With oxidation
print(calculate_peptide_mz("(Acetyl)PEPTIDEK(Acetyl)", 2)) # Acetylated
Generate Complete Fragment Ion Series
def generate_fragment_ions(sequence_str, charge_states=[1, 2]):
"""Generate comprehensive fragment ion list."""
peptide = oms.AASequence.fromString(sequence_str)
proton_mass = 1.007276
fragments = []
for i in range(1, peptide.size()):
# b and y ions
b_frag = peptide.getPrefix(i)
y_frag = peptide.getSuffix(i)
for z in charge_states:
b_mz = (b_frag.getMonoWeight() + z * proton_mass) / z
y_mz = (y_frag.getMonoWeight() + z * proton_mass) / z
fragments.append({
'type': 'b',
'position': i,
'charge': z,
'mz': b_mz
})
fragments.append({
'type': 'y',
'position': i,
'charge': z,
'mz': y_mz
})
return fragments
# Usage
ions = generate_fragment_ions("PEPTIDE", charge_states=[1, 2])
for ion in ions:
print(f"{ion['type']}{ion['position']}^{ion['charge']}+: {ion['mz']:.4f}")
Digest Protein and Calculate Peptide Masses
def digest_and_calculate(protein_seq_str, enzyme="Trypsin", missed_cleavages=2,
min_mass=600, max_mass=4000):
"""Digest protein and return valid peptides with masses."""
dig = oms.ProteaseDigestion()
dig.setEnzyme(enzyme)
dig.setMissedCleavages(missed_cleavages)
protein = oms.AASequence.fromString(protein_seq_str)
peptides = []
dig.digest(protein, peptides)
results = []
for pep in peptides:
mass = pep.getMonoWeight()
if min_mass <= mass <= max_mass:
results.append({
'sequence': pep.toString(),
'mass': mass,
'length': pep.size()
})
return results
# Usage
protein = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK"
peptides = digest_and_calculate(protein)
for pep in peptides:
print(f"{pep['sequence']}: {pep['mass']:.2f} Da ({pep['length']} aa)")