mirror of
https://github.com/K-Dense-AI/claude-scientific-skills.git
synced 2026-03-29 07:43:46 +08:00
870 lines
24 KiB
Markdown
870 lines
24 KiB
Markdown
---
|
|
name: gget
|
|
description: "Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis. Best for interactive exploration, simple queries. For batch processing or advanced BLAST use biopython; for multi-database Python workflows use bioservices."
|
|
license: BSD-2-Clause license
|
|
metadata:
|
|
skill-author: K-Dense Inc.
|
|
---
|
|
|
|
# gget
|
|
|
|
## Overview
|
|
|
|
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
|
|
|
|
**Important**: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
|
|
|
|
## Installation
|
|
|
|
Install gget in a clean virtual environment to avoid conflicts:
|
|
|
|
```bash
|
|
# Using uv (recommended)
|
|
uv uv pip install gget
|
|
|
|
# Or using pip
|
|
uv pip install --upgrade gget
|
|
|
|
# In Python/Jupyter
|
|
import gget
|
|
```
|
|
|
|
## Quick Start
|
|
|
|
Basic usage pattern for all modules:
|
|
|
|
```bash
|
|
# Command-line
|
|
gget <module> [arguments] [options]
|
|
|
|
# Python
|
|
gget.module(arguments, options)
|
|
```
|
|
|
|
Most modules return:
|
|
- **Command-line**: JSON (default) or CSV with `-csv` flag
|
|
- **Python**: DataFrame or dictionary
|
|
|
|
Common flags across modules:
|
|
- `-o/--out`: Save results to file
|
|
- `-q/--quiet`: Suppress progress information
|
|
- `-csv`: Return CSV format (command-line only)
|
|
|
|
## Module Categories
|
|
|
|
### 1. Reference & Gene Information
|
|
|
|
#### gget ref - Reference Genome Downloads
|
|
|
|
Retrieve download links and metadata for Ensembl reference genomes.
|
|
|
|
**Parameters**:
|
|
- `species`: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
|
|
- `-w/--which`: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
|
|
- `-r/--release`: Ensembl release number (default: latest)
|
|
- `-l/--list_species`: List available vertebrate species
|
|
- `-liv/--list_iv_species`: List available invertebrate species
|
|
- `-ftp`: Return only FTP links
|
|
- `-d/--download`: Download files (requires curl)
|
|
|
|
**Examples**:
|
|
```bash
|
|
# List available species
|
|
gget ref --list_species
|
|
|
|
# Get all reference files for human
|
|
gget ref homo_sapiens
|
|
|
|
# Download only GTF annotation for mouse
|
|
gget ref -w gtf -d mouse
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.ref("homo_sapiens")
|
|
gget.ref("mus_musculus", which="gtf", download=True)
|
|
```
|
|
|
|
#### gget search - Gene Search
|
|
|
|
Locate genes by name or description across species.
|
|
|
|
**Parameters**:
|
|
- `searchwords`: One or more search terms (case-insensitive)
|
|
- `-s/--species`: Target species (e.g., 'homo_sapiens', 'mouse')
|
|
- `-r/--release`: Ensembl release number
|
|
- `-t/--id_type`: Return 'gene' (default) or 'transcript'
|
|
- `-ao/--andor`: 'or' (default) finds ANY searchword; 'and' requires ALL
|
|
- `-l/--limit`: Maximum results to return
|
|
|
|
**Returns**: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Search for GABA-related genes in human
|
|
gget search -s human gaba gamma-aminobutyric
|
|
|
|
# Find specific gene, require all terms
|
|
gget search -s mouse -ao and pax7 transcription
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
|
|
```
|
|
|
|
#### gget info - Gene/Transcript Information
|
|
|
|
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
|
|
|
|
**Parameters**:
|
|
- `ens_ids`: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
|
|
- `-n/--ncbi`: Disable NCBI data retrieval
|
|
- `-u/--uniprot`: Disable UniProt data retrieval
|
|
- `-pdb`: Include PDB identifiers (increases runtime)
|
|
|
|
**Returns**: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get info for multiple genes
|
|
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
|
|
|
|
# Include PDB IDs
|
|
gget info ENSG00000034713 -pdb
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
|
|
```
|
|
|
|
#### gget seq - Sequence Retrieval
|
|
|
|
Fetch nucleotide or amino acid sequences for genes and transcripts.
|
|
|
|
**Parameters**:
|
|
- `ens_ids`: One or more Ensembl identifiers
|
|
- `-t/--translate`: Fetch amino acid sequences instead of nucleotide
|
|
- `-iso/--isoforms`: Return all transcript variants (gene IDs only)
|
|
|
|
**Returns**: FASTA format sequences
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get nucleotide sequences
|
|
gget seq ENSG00000034713 ENSG00000104853
|
|
|
|
# Get all protein isoforms
|
|
gget seq -t -iso ENSG00000034713
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
|
|
```
|
|
|
|
### 2. Sequence Analysis & Alignment
|
|
|
|
#### gget blast - BLAST Searches
|
|
|
|
BLAST nucleotide or amino acid sequences against standard databases.
|
|
|
|
**Parameters**:
|
|
- `sequence`: Sequence string or path to FASTA/.txt file
|
|
- `-p/--program`: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
|
|
- `-db/--database`:
|
|
- Nucleotide: nt, refseq_rna, pdbnt
|
|
- Protein: nr, swissprot, pdbaa, refseq_protein
|
|
- `-l/--limit`: Max hits (default: 50)
|
|
- `-e/--expect`: E-value cutoff (default: 10.0)
|
|
- `-lcf/--low_comp_filt`: Enable low complexity filtering
|
|
- `-mbo/--megablast_off`: Disable MegaBLAST (blastn only)
|
|
|
|
**Examples**:
|
|
```bash
|
|
# BLAST protein sequence
|
|
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
|
|
|
|
# BLAST from file with specific database
|
|
gget blast sequence.fasta -db swissprot -l 10
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.blast("MKWMFK...", database="swissprot", limit=10)
|
|
```
|
|
|
|
#### gget blat - BLAT Searches
|
|
|
|
Locate genomic positions of sequences using UCSC BLAT.
|
|
|
|
**Parameters**:
|
|
- `sequence`: Sequence string or path to FASTA/.txt file
|
|
- `-st/--seqtype`: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
|
|
- `-a/--assembly`: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)
|
|
|
|
**Returns**: genome, query size, alignment positions, matches, mismatches, alignment percentage
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Find genomic location in human
|
|
gget blat ATCGATCGATCGATCG
|
|
|
|
# Search in different assembly
|
|
gget blat -a mm39 ATCGATCGATCGATCG
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
|
|
```
|
|
|
|
#### gget muscle - Multiple Sequence Alignment
|
|
|
|
Align multiple nucleotide or amino acid sequences using Muscle5.
|
|
|
|
**Parameters**:
|
|
- `fasta`: Sequences or path to FASTA/.txt file
|
|
- `-s5/--super5`: Use Super5 algorithm for faster processing (large datasets)
|
|
|
|
**Returns**: Aligned sequences in ClustalW format or aligned FASTA (.afa)
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Align sequences from file
|
|
gget muscle sequences.fasta -o aligned.afa
|
|
|
|
# Use Super5 for large dataset
|
|
gget muscle large_dataset.fasta -s5
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.muscle("sequences.fasta", save=True)
|
|
```
|
|
|
|
#### gget diamond - Local Sequence Alignment
|
|
|
|
Perform fast local protein or translated DNA alignment using DIAMOND.
|
|
|
|
**Parameters**:
|
|
- Query: Sequences (string/list) or FASTA file path
|
|
- `--reference`: Reference sequences (string/list) or FASTA file path (required)
|
|
- `--sensitivity`: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
|
|
- `--threads`: CPU threads (default: 1)
|
|
- `--diamond_db`: Save database for reuse
|
|
- `--translated`: Enable nucleotide-to-amino acid alignment
|
|
|
|
**Returns**: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Align against reference
|
|
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
|
|
|
|
# Save database for reuse
|
|
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
|
|
```
|
|
|
|
### 3. Structural & Protein Analysis
|
|
|
|
#### gget pdb - Protein Structures
|
|
|
|
Query RCSB Protein Data Bank for structure and metadata.
|
|
|
|
**Parameters**:
|
|
- `pdb_id`: PDB identifier (e.g., '7S7U')
|
|
- `-r/--resource`: Data type (pdb, entry, pubmed, assembly, entity types)
|
|
- `-i/--identifier`: Assembly, entity, or chain ID
|
|
|
|
**Returns**: PDB format (structures) or JSON (metadata)
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Download PDB structure
|
|
gget pdb 7S7U -o 7S7U.pdb
|
|
|
|
# Get metadata
|
|
gget pdb 7S7U -r entry
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.pdb("7S7U", save=True)
|
|
```
|
|
|
|
#### gget alphafold - Protein Structure Prediction
|
|
|
|
Predict 3D protein structures using simplified AlphaFold2.
|
|
|
|
**Setup Required**:
|
|
```bash
|
|
# Install OpenMM first
|
|
uv pip install openmm
|
|
|
|
# Then setup AlphaFold
|
|
gget setup alphafold
|
|
```
|
|
|
|
**Parameters**:
|
|
- `sequence`: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
|
|
- `-mr/--multimer_recycles`: Recycling iterations (default: 3; recommend 20 for accuracy)
|
|
- `-mfm/--multimer_for_monomer`: Apply multimer model to single proteins
|
|
- `-r/--relax`: AMBER relaxation for top-ranked model
|
|
- `plot`: Python-only; generate interactive 3D visualization (default: True)
|
|
- `show_sidechains`: Python-only; include side chains (default: True)
|
|
|
|
**Returns**: PDB structure file, JSON alignment error data, optional 3D visualization
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Predict single protein structure
|
|
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
|
|
|
|
# Predict multimer with higher accuracy
|
|
gget alphafold sequence1.fasta -mr 20 -r
|
|
```
|
|
|
|
```python
|
|
# Python with visualization
|
|
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
|
|
|
|
# Multimer prediction
|
|
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
|
|
```
|
|
|
|
#### gget elm - Eukaryotic Linear Motifs
|
|
|
|
Predict Eukaryotic Linear Motifs in protein sequences.
|
|
|
|
**Setup Required**:
|
|
```bash
|
|
gget setup elm
|
|
```
|
|
|
|
**Parameters**:
|
|
- `sequence`: Amino acid sequence or UniProt Acc
|
|
- `-u/--uniprot`: Indicates sequence is UniProt Acc
|
|
- `-e/--expand`: Include protein names, organisms, references
|
|
- `-s/--sensitivity`: DIAMOND alignment sensitivity (default: "very-sensitive")
|
|
- `-t/--threads`: Number of threads (default: 1)
|
|
|
|
**Returns**: Two outputs:
|
|
1. **ortholog_df**: Linear motifs from orthologous proteins
|
|
2. **regex_df**: Motifs directly matched in input sequence
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Predict motifs from sequence
|
|
gget elm LIAQSIGQASFV -o results
|
|
|
|
# Use UniProt accession with expanded info
|
|
gget elm --uniprot Q02410 -e
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
|
|
```
|
|
|
|
### 4. Expression & Disease Data
|
|
|
|
#### gget archs4 - Gene Correlation & Tissue Expression
|
|
|
|
Query ARCHS4 database for correlated genes or tissue expression data.
|
|
|
|
**Parameters**:
|
|
- `gene`: Gene symbol or Ensembl ID (with `--ensembl` flag)
|
|
- `-w/--which`: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)
|
|
- `-s/--species`: 'human' (default) or 'mouse' (tissue data only)
|
|
- `-e/--ensembl`: Input is Ensembl ID
|
|
|
|
**Returns**:
|
|
- **Correlation mode**: Gene symbols, Pearson correlation coefficients
|
|
- **Tissue mode**: Tissue identifiers, min/Q1/median/Q3/max expression values
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get correlated genes
|
|
gget archs4 ACE2
|
|
|
|
# Get tissue expression
|
|
gget archs4 -w tissue ACE2
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.archs4("ACE2", which="tissue")
|
|
```
|
|
|
|
#### gget cellxgene - Single-Cell RNA-seq Data
|
|
|
|
Query CZ CELLxGENE Discover Census for single-cell data.
|
|
|
|
**Setup Required**:
|
|
```bash
|
|
gget setup cellxgene
|
|
```
|
|
|
|
**Parameters**:
|
|
- `--gene` (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)
|
|
- `--tissue`: Tissue type(s)
|
|
- `--cell_type`: Specific cell type(s)
|
|
- `--species` (-s): 'homo_sapiens' (default) or 'mus_musculus'
|
|
- `--census_version` (-cv): Version ("stable", "latest", or dated)
|
|
- `--ensembl` (-e): Use Ensembl IDs
|
|
- `--meta_only` (-mo): Return metadata only
|
|
- Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type
|
|
|
|
**Returns**: AnnData object with count matrices and metadata (or metadata-only dataframes)
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get single-cell data for specific genes and cell types
|
|
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad
|
|
|
|
# Metadata only
|
|
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
|
|
```
|
|
|
|
#### gget enrichr - Enrichment Analysis
|
|
|
|
Perform ontology enrichment analysis on gene lists using Enrichr.
|
|
|
|
**Parameters**:
|
|
- `genes`: Gene symbols or Ensembl IDs
|
|
- `-db/--database`: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')
|
|
- `-s/--species`: human (default), mouse, fly, yeast, worm, fish
|
|
- `-bkg_l/--background_list`: Background genes for comparison
|
|
- `-ko/--kegg_out`: Save KEGG pathway images with highlighted genes
|
|
- `plot`: Python-only; generate graphical results
|
|
|
|
**Database Shortcuts**:
|
|
- 'pathway' → KEGG_2021_Human
|
|
- 'transcription' → ChEA_2016
|
|
- 'ontology' → GO_Biological_Process_2021
|
|
- 'diseases_drugs' → GWAS_Catalog_2019
|
|
- 'celltypes' → PanglaoDB_Augmented_2021
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Enrichment analysis for ontology
|
|
gget enrichr -db ontology ACE2 AGT AGTR1
|
|
|
|
# Save KEGG pathways
|
|
gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
|
|
```
|
|
|
|
```python
|
|
# Python with plot
|
|
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
|
|
```
|
|
|
|
#### gget bgee - Orthology & Expression
|
|
|
|
Retrieve orthology and gene expression data from Bgee database.
|
|
|
|
**Parameters**:
|
|
- `ens_id`: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported when `type=expression`
|
|
- `-t/--type`: 'orthologs' (default) or 'expression'
|
|
|
|
**Returns**:
|
|
- **Orthologs mode**: Matching genes across species with IDs, names, taxonomic info
|
|
- **Expression mode**: Anatomical entities, confidence scores, expression status
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get orthologs
|
|
gget bgee ENSG00000169194
|
|
|
|
# Get expression data
|
|
gget bgee ENSG00000169194 -t expression
|
|
|
|
# Multiple genes
|
|
gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.bgee("ENSG00000169194", type="orthologs")
|
|
```
|
|
|
|
#### gget opentargets - Disease & Drug Associations
|
|
|
|
Retrieve disease and drug associations from OpenTargets.
|
|
|
|
**Parameters**:
|
|
- Ensembl gene ID (required)
|
|
- `-r/--resource`: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions
|
|
- `-l/--limit`: Cap results count
|
|
- Filter arguments (vary by resource):
|
|
- drugs: `--filter_disease`
|
|
- pharmacogenetics: `--filter_drug`
|
|
- expression/depmap: `--filter_tissue`, `--filter_anat_sys`, `--filter_organ`
|
|
- interactions: `--filter_protein_a`, `--filter_protein_b`, `--filter_gene_b`
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Get associated diseases
|
|
gget opentargets ENSG00000169194 -r diseases -l 5
|
|
|
|
# Get associated drugs
|
|
gget opentargets ENSG00000169194 -r drugs -l 10
|
|
|
|
# Get tissue expression
|
|
gget opentargets ENSG00000169194 -r expression --filter_tissue brain
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
|
|
```
|
|
|
|
#### gget cbio - cBioPortal Cancer Genomics
|
|
|
|
Plot cancer genomics heatmaps using cBioPortal data.
|
|
|
|
**Two subcommands**:
|
|
|
|
**search** - Find study IDs:
|
|
```bash
|
|
gget cbio search breast lung
|
|
```
|
|
|
|
**plot** - Generate heatmaps:
|
|
|
|
**Parameters**:
|
|
- `-s/--study_ids`: Space-separated cBioPortal study IDs (required)
|
|
- `-g/--genes`: Space-separated gene names or Ensembl IDs (required)
|
|
- `-st/--stratification`: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)
|
|
- `-vt/--variation_type`: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)
|
|
- `-f/--filter`: Filter by column value (e.g., 'study_id:msk_impact_2017')
|
|
- `-dd/--data_dir`: Cache directory (default: ./gget_cbio_cache)
|
|
- `-fd/--figure_dir`: Output directory (default: ./gget_cbio_figures)
|
|
- `-dpi`: Resolution (default: 100)
|
|
- `-sh/--show`: Display plot in window
|
|
- `-nc/--no_confirm`: Skip download confirmations
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Search for studies
|
|
gget cbio search esophag ovary
|
|
|
|
# Create heatmap
|
|
gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.cbio_search(["esophag", "ovary"])
|
|
gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
|
|
```
|
|
|
|
#### gget cosmic - COSMIC Database
|
|
|
|
Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
|
|
|
|
**Important**: License fees apply for commercial use. Requires COSMIC account credentials.
|
|
|
|
**Parameters**:
|
|
- `searchterm`: Gene name, Ensembl ID, mutation notation, or sample ID
|
|
- `-ctp/--cosmic_tsv_path`: Path to downloaded COSMIC TSV file (required for querying)
|
|
- `-l/--limit`: Maximum results (default: 100)
|
|
|
|
**Database download flags**:
|
|
- `-d/--download_cosmic`: Activate download mode
|
|
- `-gm/--gget_mutate`: Create version for gget mutate
|
|
- `-cp/--cosmic_project`: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)
|
|
- `-cv/--cosmic_version`: COSMIC version
|
|
- `-gv/--grch_version`: Human reference genome (37 or 38)
|
|
- `--email`, `--password`: COSMIC credentials
|
|
|
|
**Examples**:
|
|
```bash
|
|
# First download database
|
|
gget cosmic -d --email user@example.com --password xxx -cp cancer
|
|
|
|
# Then query
|
|
gget cosmic EGFR -ctp cosmic_data.tsv -l 10
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
|
|
```
|
|
|
|
### 5. Additional Tools
|
|
|
|
#### gget mutate - Generate Mutated Sequences
|
|
|
|
Generate mutated nucleotide sequences from mutation annotations.
|
|
|
|
**Parameters**:
|
|
- `sequences`: FASTA file path or direct sequence input (string/list)
|
|
- `-m/--mutations`: CSV/TSV file or DataFrame with mutation data (required)
|
|
- `-mc/--mut_column`: Mutation column name (default: 'mutation')
|
|
- `-sic/--seq_id_column`: Sequence ID column (default: 'seq_ID')
|
|
- `-mic/--mut_id_column`: Mutation ID column
|
|
- `-k/--k`: Length of flanking sequences (default: 30 nucleotides)
|
|
|
|
**Returns**: Mutated sequences in FASTA format
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Single mutation
|
|
gget mutate ATCGCTAAGCT -m "c.4G>T"
|
|
|
|
# Multiple sequences with mutations from file
|
|
gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
import pandas as pd
|
|
mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]})
|
|
gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
|
|
```
|
|
|
|
#### gget gpt - OpenAI Text Generation
|
|
|
|
Generate natural language text using OpenAI's API.
|
|
|
|
**Setup Required**:
|
|
```bash
|
|
gget setup gpt
|
|
```
|
|
|
|
**Important**: Free tier limited to 3 months after account creation. Set monthly billing limits.
|
|
|
|
**Parameters**:
|
|
- `prompt`: Text input for generation (required)
|
|
- `api_key`: OpenAI authentication (required)
|
|
- Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
|
|
- Default model: gpt-3.5-turbo (configurable)
|
|
|
|
**Examples**:
|
|
```bash
|
|
gget gpt "Explain CRISPR" --api_key your_key_here
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.gpt("Explain CRISPR", api_key="your_key_here")
|
|
```
|
|
|
|
#### gget setup - Install Dependencies
|
|
|
|
Install/download third-party dependencies for specific modules.
|
|
|
|
**Parameters**:
|
|
- `module`: Module name requiring dependency installation
|
|
- `-o/--out`: Output folder path (elm module only)
|
|
|
|
**Modules requiring setup**:
|
|
- `alphafold` - Downloads ~4GB of model parameters
|
|
- `cellxgene` - Installs cellxgene-census (may not support latest Python)
|
|
- `elm` - Downloads local ELM database
|
|
- `gpt` - Configures OpenAI integration
|
|
|
|
**Examples**:
|
|
```bash
|
|
# Setup AlphaFold
|
|
gget setup alphafold
|
|
|
|
# Setup ELM with custom directory
|
|
gget setup elm -o /path/to/elm_data
|
|
```
|
|
|
|
```python
|
|
# Python
|
|
gget.setup("alphafold")
|
|
```
|
|
|
|
## Common Workflows
|
|
|
|
### Workflow 1: Gene Discovery to Sequence Analysis
|
|
|
|
Find and analyze genes of interest:
|
|
|
|
```python
|
|
# 1. Search for genes
|
|
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
|
|
|
|
# 2. Get detailed information
|
|
gene_ids = results["ensembl_id"].tolist()
|
|
info = gget.info(gene_ids[:5])
|
|
|
|
# 3. Retrieve sequences
|
|
sequences = gget.seq(gene_ids[:5], translate=True)
|
|
```
|
|
|
|
### Workflow 2: Sequence Alignment and Structure
|
|
|
|
Align sequences and predict structures:
|
|
|
|
```python
|
|
# 1. Align multiple sequences
|
|
alignment = gget.muscle("sequences.fasta")
|
|
|
|
# 2. Find similar sequences
|
|
blast_results = gget.blast(my_sequence, database="swissprot", limit=10)
|
|
|
|
# 3. Predict structure
|
|
structure = gget.alphafold(my_sequence, plot=True)
|
|
|
|
# 4. Find linear motifs
|
|
ortholog_df, regex_df = gget.elm(my_sequence)
|
|
```
|
|
|
|
### Workflow 3: Gene Expression and Enrichment
|
|
|
|
Analyze expression patterns and functional enrichment:
|
|
|
|
```python
|
|
# 1. Get tissue expression
|
|
tissue_expr = gget.archs4("ACE2", which="tissue")
|
|
|
|
# 2. Find correlated genes
|
|
correlated = gget.archs4("ACE2", which="correlation")
|
|
|
|
# 3. Get single-cell data
|
|
adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell")
|
|
|
|
# 4. Perform enrichment analysis
|
|
gene_list = correlated["gene_symbol"].tolist()[:50]
|
|
enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
|
|
```
|
|
|
|
### Workflow 4: Disease and Drug Analysis
|
|
|
|
Investigate disease associations and therapeutic targets:
|
|
|
|
```python
|
|
# 1. Search for genes
|
|
genes = gget.search(["breast cancer"], species="homo_sapiens")
|
|
|
|
# 2. Get disease associations
|
|
diseases = gget.opentargets("ENSG00000169194", resource="diseases")
|
|
|
|
# 3. Get drug associations
|
|
drugs = gget.opentargets("ENSG00000169194", resource="drugs")
|
|
|
|
# 4. Query cancer genomics data
|
|
study_ids = gget.cbio_search(["breast"])
|
|
gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type")
|
|
|
|
# 5. Search COSMIC for mutations
|
|
cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
|
|
```
|
|
|
|
### Workflow 5: Comparative Genomics
|
|
|
|
Compare proteins across species:
|
|
|
|
```python
|
|
# 1. Get orthologs
|
|
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
|
|
|
|
# 2. Get sequences for comparison
|
|
human_seq = gget.seq("ENSG00000169194", translate=True)
|
|
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
|
|
|
|
# 3. Align sequences
|
|
alignment = gget.muscle([human_seq, mouse_seq])
|
|
|
|
# 4. Compare structures
|
|
human_structure = gget.pdb("7S7U")
|
|
mouse_structure = gget.alphafold(mouse_seq)
|
|
```
|
|
|
|
### Workflow 6: Building Reference Indices
|
|
|
|
Prepare reference data for downstream analysis (e.g., kallisto|bustools):
|
|
|
|
```bash
|
|
# 1. List available species
|
|
gget ref --list_species
|
|
|
|
# 2. Download reference files
|
|
gget ref -w gtf -w cdna -d homo_sapiens
|
|
|
|
# 3. Build kallisto index
|
|
kallisto index -i transcriptome.idx transcriptome.fasta
|
|
|
|
# 4. Download genome for alignment
|
|
gget ref -w dna -d homo_sapiens
|
|
```
|
|
|
|
## Best Practices
|
|
|
|
### Data Retrieval
|
|
- Use `--limit` to control result sizes for large queries
|
|
- Save results with `-o/--out` for reproducibility
|
|
- Check database versions/releases for consistency across analyses
|
|
- Use `--quiet` in production scripts to reduce output
|
|
|
|
### Sequence Analysis
|
|
- For BLAST/BLAT, start with default parameters, then adjust sensitivity
|
|
- Use `gget diamond` with `--threads` for faster local alignment
|
|
- Save DIAMOND databases with `--diamond_db` for repeated queries
|
|
- For multiple sequence alignment, use `-s5/--super5` for large datasets
|
|
|
|
### Expression and Disease Data
|
|
- Gene symbols are case-sensitive in cellxgene (e.g., 'PAX7' vs 'Pax7')
|
|
- Run `gget setup` before first use of alphafold, cellxgene, elm, gpt
|
|
- For enrichment analysis, use database shortcuts for convenience
|
|
- Cache cBioPortal data with `-dd` to avoid repeated downloads
|
|
|
|
### Structure Prediction
|
|
- AlphaFold multimer predictions: use `-mr 20` for higher accuracy
|
|
- Use `-r` flag for AMBER relaxation of final structures
|
|
- Visualize results in Python with `plot=True`
|
|
- Check PDB database first before running AlphaFold predictions
|
|
|
|
### Error Handling
|
|
- Database structures change; update gget regularly: `uv pip install --upgrade gget`
|
|
- Process max ~1000 Ensembl IDs at once with gget info
|
|
- For large-scale analyses, implement rate limiting for API queries
|
|
- Use virtual environments to avoid dependency conflicts
|
|
|
|
## Output Formats
|
|
|
|
### Command-line
|
|
- Default: JSON
|
|
- CSV: Add `-csv` flag
|
|
- FASTA: gget seq, gget mutate
|
|
- PDB: gget pdb, gget alphafold
|
|
- PNG: gget cbio plot
|
|
|
|
### Python
|
|
- Default: DataFrame or dictionary
|
|
- JSON: Add `json=True` parameter
|
|
- Save to file: Add `save=True` or specify `out="filename"`
|
|
- AnnData: gget cellxgene
|
|
|
|
## Resources
|
|
|
|
This skill includes reference documentation for detailed module information:
|
|
|
|
### references/
|
|
- `module_reference.md` - Comprehensive parameter reference for all modules
|
|
- `database_info.md` - Information about queried databases and their update frequencies
|
|
- `workflows.md` - Extended workflow examples and use cases
|
|
|
|
For additional help:
|
|
- Official documentation: https://pachterlab.github.io/gget/
|
|
- GitHub issues: https://github.com/pachterlab/gget/issues
|
|
- Citation: Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836
|
|
|